| ![]() |
| To navigate upstream or downstream, click on the first or last gene | Download image in PDF format |
| Functional category | intermediary metabolism and respiration |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). |
| Transcriptome | mRNA identified by microarray analysis and down-regulated after 96h of starvation (see Betts et al., 2002). |
| Annotation Changes | proteomics updated on 01-APR-2009 |
| Coordinates | |||
|---|---|---|---|
| Type | Start | End | Orientation | CDS | 14914 | 15612 | + |
| Protein sequence in FASTA format | ||
|---|---|---|
| >M. tuberculosis H37Rv | trpG MRILVVDNYDSFVFNLVQYLGQLGIEAEVWRNDDHRLSDEAAVAGQFDGVLLSPGPGTPERAGASVSIVHACAAAHTPLL GVCLGHQAIGVAFGATVDRAPELLHGKTSSVFHTNVGVLQGLPDPFTATRYHSLTILPKSLPAVLRVTARTSSGVIMAVQ HTGLPIHGVQFHPESILTEGGHRILANWLTCCGWTQDDTLVRRLENEVLTAISPHFPTSTASAGEATGRTSA | ||
| Blastp: results | ||
| TransMembrane prediction using Hidden Markov Models: tmhmm | ||
| Microbe Genome Browser | ||
| Genomic sequence | ||
| Structural information | ||
|---|---|---|
| Protein Data Bank | No structure available | |
| PFAM | Protein Family Domains | |
| Orthologs/Cross-references | ||
|---|---|---|
| CDC1551 | MT0016 | |
| Enzyme Classification | 4.1.3.27 | |
| Gene Ontology | anthranilate synthase activity glutamine metabolic process biosynthetic process transferase activity | |
| Mbovis | Mb0013 | |
| Mleprae | ML0015 | |
| Msmegmatis | MSMEG_0029 | |
| UniProt | Q7DAK6 | |
| Interacting Drugs/Compounds | ||
|---|---|---|
| TDR Targets | Rv0013 | |
| Expression Data | ||
|---|---|---|
| TBDB | Rv0013 | |
| Bibliography | ||
|---|---|---|
| Betts JC, Lukey PT, Robb LC, McAdam RA, Duncan K, Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling Mol Microbiol (2002) 43 :717 | ||
| Gu S, Chen J, Dobos KM, Bradbury EM, Belisle JT, Chen X, Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Mol Cell Proteomics (2003) 2(12):1284-96 | ||