| ![]() |
| To navigate upstream or downstream, click on the first or last gene | Download image in PDF format |
| Functional category | cell wall and cell processes |
| Mutation | non essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for survival in primary murine macrophages, by transposon site hybridization (TraSH) in H37Rv (See Rengarajan et al., 2005). mutants available at TARGET website |
| Annotation Changes | mutant updated on 14-MAR-2008 |
| Coordinates | |||
|---|---|---|---|
| Type | Start | End | Orientation | CDS | 20231 | 21640 | - |
| Protein sequence in FASTA format | ||
|---|---|---|
| >M. tuberculosis H37Rv | rodA MTTRLQAPVAVTPPLPTRRNAELLLLCFAAVITFAALLVVQANQDQGVPWDLTSYGLAFLTLFGSAHLAIRRFAPYTDPL LLPVVALLNGLGLVMIHRLDLVDNEIGEHRHPSANQQMLWTLVGVAAFALVVTFLKDHRQLARYGYICGLAGLVFLAVPA LLPAALSEQNGAKIWIRLPGFSIQPAEFSKILLLIFFSAVLVAKRGLFTSAGKHLLGMTLPRPRDLAPLLAAWVISVGVM VFEKDLGASLLLYTSFLVVVYLATQRFSWVVIGLTLFAAGTLVAYFIFEHVRLRVQTWLDPFADPDGTGYQIVQSLFSFA TGGIFGTGLGNGQPDTVPAASTDFIIAAFGEELGLVGLTAILMLYTIVIIRGLRTAIATRDSFGKLLAAGLSSTLAIQLF IVVGGVTRLIPLTGLTTPWMSYGGSSLLANYILLAILARISHGARRPLRTRPRNKSPITAAGTEVIERV | ||
| Blastp: results | ||
| TransMembrane prediction using Hidden Markov Models: tmhmm | ||
| Microbe Genome Browser | ||
| Genomic sequence | ||
| Structural information | ||
|---|---|---|
| Protein Data Bank | No structure available | |
| PFAM | Protein Family Domains | |
| Orthologs/Cross-references | ||
|---|---|---|
| CDC1551 | MT0020 | |
| Gene Ontology | plasma membrane cell wall organization cell cycle regulation of cell shape peptidoglycan biosynthetic process integral to membrane cell division | |
| Mbovis | Mb0017c | |
| Mleprae | ML0019 | |
| Msmegmatis | MSMEG_0032 | |
| UniProt | P63760 | |
| Interacting Drugs/Compounds | ||
|---|---|---|
| TDR Targets | Rv0017c | |
| Expression Data | ||
|---|---|---|
| TBDB | Rv0017c | |
| Bibliography | ||
|---|---|---|
| Sassetti CM, Boyd DH, Rubin EJ, Genes required for mycobacterial growth defined by high density mutagenesis. Mol Microbiol (2003) 48(1):77-84 | ||
| Rengarajan J, Bloom BR, Rubin EJ, Genome-wide requirements for Mycobacterium tuberculosis adaptation and survival in macrophages. Proc Natl Acad Sci U S A (2005) 102:8327 | ||