Quick Search

Enter gene name or accession number


Search term: regX3

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameregX3
Rv numberRv0491
TypeCDS
FunctionTranscriptional regulatory protein part of the two component regulatory system REGX3/SENX3.
ProductTwo component sensory transduction protein RegX3 (transcriptional regulatory protein) (probably LuxR-family)
CommentsRv0491, (MTCY20G9.17), len: 227 aa. RegX3, response regulator protein (sensory transduction protein) (see citations below), equivalent to O07130|RGX3_MYCBO|REGX3 sensory transduction protein from Mycobacterium bovis BCG (227 aa); AAG09797.1|AF258346_2|AF258346|REGX3 response regulator from Mycobacterium smegmatis (228 aa); equivalent to P54884|RGX3_MYCLE|REGX3 sensory transduction protein from Mycobacterium leprae (198 aa), FASTA scores : E(): 0, (95.4% identity in 197 aa overlap). Also highly similar to other response regulators e.g. AAG43239.1|AF123314_2 |AF123314 putative response regulator from Corynebacterium glutamicum (232 aa).
Molecular mass (Da)24849.4
Isoelectric point4.5809
Gene length (bp)684
Protein length227
Location (kb)580.809


Functional categoryregulatory proteins


ProteomicsProteomics shows upregulation in isoniazid-resistant M. tuberculosis clinical isolates (See Jiang et al., 2006).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Growth of M. tuberculosis Mt103 transposon mutant in BALB/c mice and in mouse bone marrow-derived macrophages is unaffected (See Ewann et al., 2002). M. tuberculosis H37Rv senX3-regX3 mutant has reduced ability to survive in THP-1 and bone-marrow-derived macrophages; mutant is attenuated in SCID and DBA/2 mice (See Parish et al., 2003).
see TB knockouts/mutants availability
RegulonPredicted to be in the SenX3|Rv0490-RegX3|Rv0491 regulon (See Parish et al., 2003).


Coordinates
TypeStartEndOrientation
CDS580809581492+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv0491|regX3
MTSVLIVEDEESLADPLAFLLRKEGFEATVVTDGPAALAEFDRAGADIVLLDLMLPGMSG
TDVCKQLRARSSVPVIMVTARDSEIDKVVGLELGADDYVTKPYSARELIARIRAVLRRGG
DDDSEMSDGVLESGPVRMDVERHVVSVNGDTITLPLKEFDLLEYLMRNSGRVLTRGQLID
RVWGADYVGDTKTLDVHVKRLRSKIEADPANPVHLVTVRGLGYKLEG
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
PFAMQ11156
Protein Data Bank2OQR


Orthologs/Cross-references
CDC1551MT0510
Gene Ontologytwo-component response regulator activity
two-component signal transduction system (phosphorelay)
DNA binding
transcription
regulation of transcription, DNA-dependent
M. bovisMb0501
M. lepraeML2439
M. marinumMMAR_0816
M. smegmatisMSMEG_0937
UniProtQ11156
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv0491


Expression Data
TBDBRv0491


Bibliography
Himpens S, Locht C, Supply P,
Molecular characterization of the mycobacterial SenX3 -RegX3 two-component system: evidence for autoregulation
Microbiology (2000) 146:3091-3098
Cited for: Secondary/Regulation
Ewann F, Jackson M, Pethe K, Cooper A, Mielcarek N, Ensergueix D, Gicquel B, Locht C, Supply P,
Transient requirement of the PrrA-PrrB two-component system for early intracellular multiplication of Mycobacterium tuberculosis
Infect Immun (2002) 70(5):2256-63
Cited for: Mutant
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Lamichhane G, Zignol M, Blades NJ, Geiman DE, Dougherty A, Grosset J, Broman KW, Bishai WR,
A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis.
Proc Natl Acad Sci U S A (2003) 100(12):7213-8
Cited for: Mutant
Parish T, Smith DA, Roberts G, Betts J, Stoker NG,
The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence.
Microbiology (Reading, Engl.) (2003) 149(Pt 6):1423-35
Cited for: Mutant/Regulation
Jiang X, Zhang W, Gao F, Huang Y, Lv C, Wang H,
Comparison of the proteome of isoniazid-resistant and -susceptible strains of Mycobacterium tuberculosis.
Microb Drug Resist (2006) 12(4):231-8
Cited for: Proteomics
King-Scott J, Nowak E, Mylonas E, Panjikar S, Roessle M, Svergun DI, Tucker PA,
The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state.
J Biol Chem (2007) 282(52):37717-29
Cited for: Structure
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant
Supply P, Magdalena J, Himpens S, Locht C,
Identification of novel intergenic repetitive units in a mycobacterial two -component system operon
Mol Microbiol (1997) 26(5):991-1003
Cited for: Sequence