|  |
| To navigate upstream or downstream, click on the first or last gene | Download image in PDF format |
| Functional category | information pathways |
| Proteomics | Identified in the cytosol and cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). |
| Transcriptome | mRNA identified by microarray analysis and down-regulated after 96h of starvation (see Betts et al., 2002). |
| Mutation | non essential gene by Himar1-based transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003) mutants available at TARGET website |
| Regulon | Predicted to be in the IdeR|Rv2711 regulon (See Gold et al., 2001). |
| Annotation Changes | regulon, bibliography updated on 01-JUL-2009 |
| Coordinates | |||
|---|---|---|---|
| Type | Start | End | Orientation | CDS | 3280 | 4437 | + |
| Protein sequence in FASTA format | ||
|---|---|---|
| >M. tuberculosis H37Rv | recF MYVRHLGLRDFRSWACVDLELHPGRTVFVGPNGYGKTNLIEALWYSTTLGSHRVSADLPLIRVGTDRAVISTIVVNDGRE CAVDLEIATGRVNKARLNRSSVRSTRDVVGVLRAVLFAPEDLGLVRGDPADRRRYLDDLAIVRRPAIAAVRAEYERVLRQ RTALLKSVPGARYRGDRGVFDTLEVWDSRLAEHGAELVAARIDLVNQLAPEVKKAYQLLAPESRSASIGYRASMDVTGPS EQSDIDRQLLAARLLAALAARRDAELERGVCLVGPHRDDLILRLGDQPAKGFASHGEAWSLAVALRLAAYQLLRVDGGEP VLLLDDVFAELDVMRRRALATAAESAEQVLVTAAVLEDIPAGWDARRVHIDVRADDTGSMSVVLP | ||
| Blastp: results | ||
| TransMembrane prediction using Hidden Markov Models: tmhmm | ||
| Microbe Genome Browser | ||
| Genomic sequence | ||
| Structural information | ||
|---|---|---|
| Protein Data Bank | No structure available | |
| PFAM | Protein Family Domains | |
| Orthologs/Cross-references | ||
|---|---|---|
| CDC1551 | MT0003 | |
| Gene Ontology | single-stranded DNA binding ATP binding cytoplasm DNA replication DNA repair SOS response | |
| Mbovis | Mb0003 | |
| Mleprae | ML0003 | |
| Msmegmatis | MSMEG_0003 | |
| UniProt | Q59586 | |
| Interacting Drugs/Compounds | ||
|---|---|---|
| TDR Targets | Rv0003 | |