Quick Search

Enter gene name or accession number


Search term: pknH

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene namepknH
Rv numberRv1266c
TypeCDS
FunctionInvolved in signal transduction (via phosphorylation). Thought to be involved in arabinan metabolism, phosphorylating perhaps EMBR|Rv1267c [catalytic activity: ATP + a protein = ADP + a phosphoprotein].
ProductProbable transmembrane serine/threonine-protein kinase H PknH (protein kinase H) (STPK H)
CommentsRv1266c, (MTCY50.16), len: 626 aa. Probable pknH, transmembrane serine/threonine-protein kinase (see citation below), similar to many e.g. PKN1_MYXXA|P33973 pkn1 (693 aa), FASTA scores: opt: 611, E(): 1.4e- 14, (29.7% identity in 492 aa overlap); etc. Contains PS00107 Protein kinases ATP-binding region signature; PS00108 Serine/Threonine protein kinases active-site signature. Contains Hank's kinase subdomain. Belongs to the Ser/Thr family of protein kinases. Experimental studies show evidence of auto-phosphorylation.
Molecular mass (Da)66753.9
Isoelectric point6.7405
Gene length (bp)1881
Protein length626
Location (kb)1413.96


Functional categoryregulatory proteins


ProteomicsIdentified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 90 days but not 30 days (See Kruh et al., 2010). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011).
see TB knockouts/mutants availability


Coordinates
TypeStartEndOrientation
CDS14139601415840-
RBS14158481415852-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv1266c|pknH
MSDAQDSRVGSMFGPYHLKRLLGRGGMGEVYEAEHTVKEWTVAVKLMTAEFSKDPVFRER
MKREARIAGRLQEPHVVPIHDYGEVDGQMFLEMRLVEGTDLDSVLKRFGPLTPPRAVAII
TQIASALDAAHADGVMHRDVKPQNILITRDDFAYLVDFGIASATTDEKLTQLGTAVGTWK
YMAPERFSNDEVTYRADIYALACVLHECLTGAPPYRADSAGTLVSSHLMGPIPQPSAIRP
GIPKAFDAVVARGMAKKPEDRYASAGDLALAAHEALSDPDQDHAADILRRSQESTLPAPP
KPVPPPTMPATAMAPRQPPAPPVTPPGVQPAPKPSYTPPAQPGPAGQRPGPTGQPSWAPN
SGPMPASGPTPTPQYYQGGGWGAPPSGGPSPWAQTPRKTNPWPLVAGAAAVVLVLVLGAI
GIWIAIRPKPVQPPQPVAEERLSALLLNSSEVNAVMGSSSMQPGKPITSMDSSPVTVSLP
DCQGALYTSQDPVYAGTGYTAINGLISSEPGDNYEHWVNQAVVAFPTADKARAFVQTSAD
KWKNCAGKTVTVTNKAKTYRWTFADVKGSPPTITVIDTQEGAEGWECQRAMSVANNVVVD
VNACGYRITNQAGQIAAKIVDKVNKE
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMQ11053


Orthologs/Cross-references
CDC1551MT1304
Enzyme Classification2.7.11.1
Gene Ontologyprotein serine/threonine kinase activity
ATP binding
protein amino acid phosphorylation
M. bovisMb1297c
M. marinumMMAR_4156
MMAR_4171
M. smegmatisMSMEG_5513
UniProtQ11053
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv1266c


Expression Data
TBDBRv1266c


Bibliography
Av-Gay Y, Everett M,
The eukaryotic-like Ser/Thr protein kinases of Mycobacterium tuberculosis
Trends Microbiol (2000) 8(5):238-44
Cited for: Review
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Kruh NA, Troudt J, Izzo A, Prenni J, Dobos KM,
Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo.
PLoS One (2010) 5(11):e13938
Cited for: Proteomics
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant