| ![]() |
| To navigate upstream or downstream, click on the first or last gene | Download image in PDF format |
| Functional category | cell wall and cell processes |
| Proteomics | Identified in the cytosol of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). |
| Transcriptome | mRNA identified by microarray analysis and down-regulated after 4h, 24h and 96h of starvation (see Betts et al., 2002). |
| Mutation | non essential gene by Himar1-based transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003) mutants available at TARGET website |
| Coordinates | |||
|---|---|---|---|
| Type | Start | End | Orientation | CDS | 18759 | 20234 | - |
| Protein sequence in FASTA format | ||
|---|---|---|
| >M. tuberculosis H37Rv | pbpA MNASLRRISVTVMALIVLLLLNATMTQVFTADGLRADPRNQRVLLDEYSRQRGQITAGGQLLAYSVATDGRFRFLRVYPN PEVYAPVTGFYSLRYSSTALERAEDPILNGSDRRLFGRRLADFFTGRDPRGGNVDTTINPRIQQAGWDAMQQGCYGPCKG AVVALEPSTGKILALVSSPSYDPNLLASHNPEVQAQAWQRLGDNPASPLTNRAISETYPPGSTFKVITTAAALAAGATET EQLTAAPTIPLPGSTAQLENYGGAPCGDEPTVSLREAFVKSCNTAFVQLGIRTGADALRSMARAFGLDSPPRPTPLQVAE STVGPIPDSAALGMTSIGQKDVALTPLANAEIAATIANGGITMRPYLVGSLKGPDLANISTTVGYQQRRAVSPQVAAKLT ELMVGAEKVAQQKGAIPGVQIASKTGTAEHGTDPRHTPPHAWYIAFAPAQAPKVAVAVLVENGADRLSATGGALAAPIGR AVIEAALQGEP | ||
| Blastp: results | ||
| TransMembrane prediction using Hidden Markov Models: tmhmm | ||
| Microbe Genome Browser | ||
| Genomic sequence | ||
| Structural information | ||
|---|---|---|
| Protein Data Bank | No structure available | |
| PFAM | Protein Family Domains | |
| Orthologs/Cross-references | ||
|---|---|---|
| CDC1551 | MT0019 | |
| Gene Ontology | plasma membrane cell wall organization regulation of cell shape penicillin binding peptidoglycan biosynthetic process integral to membrane transferase activity | |
| Mbovis | Mb0016c | |
| Mleprae | ML0018 | |
| Mmarinum | MMAR_0018 | |
| Msmegmatis | MSMEG_0031 | |
| UniProt | P71586 | |
| Interacting Drugs/Compounds | ||
|---|---|---|
| TDR Targets | Rv0016c | |
| Expression Data | ||
|---|---|---|
| TBDB | Rv0016c | |
| Bibliography | ||
|---|---|---|
| Betts JC, Lukey PT, Robb LC, McAdam RA, Duncan K, Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling Mol Microbiol (2002) 43 :717 | ||
| Sassetti CM, Boyd DH, Rubin EJ, Genes required for mycobacterial growth defined by high density mutagenesis. Mol Microbiol (2003) 48(1):77-84 | ||
| Lamichhane G, Zignol M, Blades NJ, Geiman DE, Dougherty A, Grosset J, Broman KW, Bishai WR, A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Proc Natl Acad Sci U S A (2003) 100 :7213 | ||
| Mawuenyega KG, Forst CV, Dobos KM, Belisle JT, Chen J, Bradbury EM, Bradbury AR, Chen X, Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Mol Biol Cell (2005) 16(1):396-404 | ||