Quick Search

Enter gene name or accession number


Search term: kdpE

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene namekdpE
Rv numberRv1027c
TypeCDS
FunctionMember of the two-component regulatory system KDPD/KDPE involved in the regulation of the KDP operon.
ProductProbable transcriptional regulatory protein KdpE
CommentsRv1027c, (MTCY10G2.22), len: 226 aa. Probable KdpE, transcriptional regulatory protein, similar to others e.g. KDPE_ECOLI|P21866 kdp operon transcriptional regulatory protein from Escherichia coli strain K12 (225 aa), FASTA scores: opt: 691, E(): 0, (47.8% identity in 224 aa overlap); AL021530|SC2E9.13 from Streptomyces coelicolor (227 aa), FASTA scores: opt: 981, E(): 0, (66.4% identity in 226 aa overlap); etc.
Molecular mass (Da)24741.4
Isoelectric point5.3679
Gene length (bp)681
Protein length226
Location (kb)1148.43


Functional categoryregulatory proteins


Mutationessential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for survival in primary murine macrophages, by transposon site hybridization (TraSH) in H37Rv (See Rengarajan et al., 2005). M. tuberculosis H37Rv kpdDE mutant shows increased virulence in SCID mice (See Parish et al., 2004).
see TB knockouts/mutants availability
RegulonPredicted to be in the RelA|Rv2583c regulon (See Dahl et al., 2003).


Coordinates
TypeStartEndOrientation
CDS11484271149107-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv1027c|kdpE
MTLVLVIDDEPQILRALRINLTVRGYQVITASTGAGALRAAAEHPPDVVILDLGLPDMSG
IDVLGGLRGWLTAPVIVLSARTDSSDKVQALDAGADDYVTKPFGMDEFLARLRAAVRRNT
AAAELEQPVIETDSFTVDLAGKKVIKDGAEVHLTPTEWGMLEMLARNRGKLVGRGELLKE
VWGPAYATETHYLRVYLAQLRRKLEDDPSHPKHLLTESGMGYRFEA
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMP96373


Orthologs/Cross-references
CDC1551MT1056
Gene Ontologytwo-component response regulator activity
two-component signal transduction system (phosphorelay)
DNA binding
transcription
regulation of transcription, DNA-dependent
M. bovisMb1055c
M. marinumMMAR_0635
M. smegmatisMSMEG_5396
UniProtP96373
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv1027c


Expression Data
TBDBRv1027c


Bibliography
Parish T, Smith DA, Kendall S, Casali N, Bancroft GJ, Stoker NG,
Deletion of two-component regulatory systems increases the virulence of Mycobacterium tuberculosis.
Infect Immun (2003) 71(3):1134-40
Cited for: Mutant/Secondary/Function
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Dahl JL, Kraus CN, Boshoff HI, Doan B, Foley K, Avarbock D, Kaplan G, Mizrahi V, Rubin H, Barry CE 3rd,
The role of RelMtb-mediated adaptation to stationary phase in long-term persistence of Mycobacterium tuberculosis in mice.
Proc Natl Acad Sci U S A (2003) 100(17):10026-31
Cited for: Regulon
Rengarajan J, Bloom BR, Rubin EJ,
Genome-wide requirements for Mycobacterium tuberculosis adaptation and survival in macrophages.
Proc Natl Acad Sci U S A (2005) 102(23):8327-32
Cited for: Mutant