Quick Search

Enter gene name or accession number


Search term: hisD

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene namehisD
Rv numberRv1599
TypeCDS
FunctionInvolved in histidine biosynthesis pathway (tenth step). This protein is considered as a bifunctional enzyme, possessing two active sites, one an alcohol dehydrogenase and the other an aldehyde dehydrogenase [catalytic activity: L-histidinol + 2 NAD(+) + H(2)O = L-histidine + 2 NADH].
ProductProbable histidinol dehydrogenase HisD (HDH)
CommentsRv1599, (MTCY336.05c), len: 438 aa. Probable hisD, histidinol dehydrogenase (see citation below) O08396. Similar to many e.g. HISX_MYCSM|P28736 from Mycobacterium smegmatis (445 aa), FASTA results: opt: 2356, E(): 0, (83.1% identity in 437 aa overlap). Contains histidinol dehydrogenase signature (PS00611).
Molecular mass (Da)45346.2
Isoelectric point4.6346
Gene length (bp)1317
Protein length438
Location (kb)1799.58


Functional categoryintermediary metabolism and respiration


ProteomicsIdentified by mass spectrometry in the culture filtrate and whole cell lysates of M. tuberculosis H37Rv but not the membrane protein fraction (See de Souza et al., 2011).
Mutationessential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011).
see TB knockouts/mutants availability


Coordinates
TypeStartEndOrientation
CDS17995831800899+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv1599|hisD
VLTRIDLRGAELTAAELRAALPRGGADVEAVLPTVRPIVAAVAERGAEAALDFGASFDGV
RPHAIRVPDAALDAALAGLDCDVCEALQVMVERTRAVHSGQRRTDVTTTLGPGATVTERW
VPVERVGLYVPGGNAVYPSSVVMNVVPAQAAGVDSLVVASPPQAQWDGMPHPTILAAARL
LGVDEVWAVGGAQAVALLAYGGTDTDGAALTPVDMITGPGNIYVTAAKRLCRSRVGIDAE
AGPTEIAILADHTADPVHVAADLISQAEHDELAASVLVTPSEDLADATDAELAGQLQTTV
HRERVTAALTGRQSAIVLVDDVDAAVLVVNAYAAEHLEIQTADAPQVASRIRSAGAIFVG
PWSPVSLGDYCAGSNHVLPTAGCARHSSGLSVQTFLRGIHVVEYTEAALKDVSGHVITLA
TAEDLPAHGEAVRRRFER
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMP63950


Orthologs/Cross-references
CDC1551MT1635
Enzyme Classification1.1.1.23
Gene Ontologyhistidine biosynthetic process
histidinol dehydrogenase activity
zinc ion binding
NAD or NADH binding
oxidation reduction
M. bovisMb1625
M. lepraeML1257
M. marinumMMAR_2395
M. smegmatisMSMEG_3205
UniProtP63950
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv1599


Expression Data
TBDBRv1599


Bibliography
Parish T, Gordhan BG, McAdam RA, Duncan K, Mizrahi V, Stoker NG,
Production of mutants in amino acid biosynthesis genes of Mycobacterium tuberculosis by homologous recombination
Microbiology (1999) 145(Pt 12):3497-503
Cited for: Mutant
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant