Quick Search

Enter gene name or accession number


Gene: fhaA

General annotation | Coordinates | Sequence | Genome Browser | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography


Imagemap from R
To navigate upstream or downstream, click on the first or last geneDownload image in PDF format

General annotation
Gene namefhaA
Rv numberRv0020c
TypeCDS
FunctionSIGNAL TRANSDUCTION
ProductCONSERVED HYPOTHETICAL PROTEIN WITH FHA DOMAIN, TB39.8
Evidenceexperimental
CommentsRv0020c, (MTCY10H4.20c), len: 527 aa. FhaA, TB39.8, conserved protein with forkhead-associated domain (IPR000253) at C-terminus, may be involved in signal transduction. Identified by proteomic study by the Statens Serum Institute, Denmark (spot TB39.8) (see citation below). Highly similar to NP_301148.1|NC_002677 conserved hypothetical protein from Mycobacterium leprae (488 aa); and Z70722|MLCB1770_15|T10015 hypothetical protein from Mycobacterium leprae (463 aa), FASTA scores: opt: 1213, E(): 2.2e-32, (72.3% identity in 506 aa overlap). Alternative start codon in position 24979 has been suggested (see citation below). A core mycobacterial gene; conserved in mycobacterial strains (See Marmiesse et al., 2004).
Molecular mass (Da)56880.1
Isoelectric point4.653
Gene length (bp)1584
Protein length528
Location (kb)25.444


Functional categoryregulatory proteins


ProteomicsIdentified by proteomics at the Max Planck Institute for Infection Biology, Berlin, Germany and the Statens Serum Institute (Denmark) (see Jungblut et al., 1999). Identified in the culture supernatant of M. tuberculosis H37Rv using mass spectrometry (See Mattow et al., 2003). Identified in the cytosol of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005).
TranscriptomemRNA identified by microarray analysis and down-regulated after 96h of starvation (see Betts et al., 2002).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Required for survival in primary murine macrophages, by transposon site hybridization (TraSH) in H37Rv (See Rengarajan et al., 2005). mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS2386125444-


Protein sequence in FASTA format
>M. tuberculosis H37Rv | fhaA
MGSQKRLVQRVERKLEQTVGDAFARIFGGSIVPQEVEALLRREAADGIQSLQGNRLLAPNEYIITLGVHDFEKLGADPEL
KSTGFARDLADYIQEQGWQTYGDVVVRFEQSSNLHTGQFRARGTVNPDVETHPPVIDCARPQSNHAFGAEPGVAPMSDNS
SYRGGQGQGRPDEYYDDRYARPQEDPRGGPDPQGGSDPRGGYPPETGGYPPQPGYPRPRHPDQGDYPEQIGYPDQGGYPE
QRGYPEQRGYPDQRGYQDQGRGYPDQGQGGYPPPYEQRPPVSPGPAAGYGAPGYDQGYRQSGGYGPSPGGGQPGYGGYGE
YGRGPARHEEGSYVPSGPPGPPEQRPAYPDQGGYDQGYQQGATTYGRQDYGGGADYTRYTESPRVPGYAPQGGGYAEPAG
RDYDYGQSGAPDYGQPAPGGYSGYGQGGYGSAGTSVTLQLDDGSGRTYQLREGSNIIGRGQDAQFRLPDTGVSRRHLEIR
WDGQVALLADLNSTNGTTVNNAPVQEWQLADGDVIRLGHSEIIVRMH*
Blastp: results
TransMembrane prediction using Hidden Markov Models: tmhmm
Microbe Genome Browser
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMProtein Family Domains


Orthologs/Cross-references
CDC1551MT0023
MbovisMb0020c
MlepraeML0022
MmarinumMMAR_0022
MsmegmatisMSMEG_0035
UniProtP71590


Interacting Drugs/Compounds
TDR TargetsRv0020c


Expression Data
TBDBRv0020c


Bibliography
Jungblut PR, Schaible UE, Mollenkopf HJ, Zimny-Arndt U, Raupach B, Mattow J, Halada P, Lamer S, Hagens K, Kaufmann SH,
Comparative proteome analysis of Mycobacterium tuberculosis and Mycobacterium bovis BCG strains: towards functional genomics of microbial pathogens
Mol Microbiol (1999) 33(6):1103-17
Rosenkrands I, Weldingh K, Jacobsen S, Hansen CV, Florio W, Gianetri I, Andersen P,
Mapping and identification of Mycobacterium tuberculosis proteins by two-dimensional gel electrophoresis, microsequencing and immunodetection
Electrophoresis (2000) 21(5):935-48
Rosenkrands I, King A, Weldingh K, Moniatte M, Moertz E, Andersen P,
Towards the proteome of Mycobacterium tuberculosis
Electrophoresis (2000) 21(17):3740-56
Betts JC, Lukey PT, Robb LC, McAdam RA, Duncan K,
Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling
Mol Microbiol (2002) 43 :717
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Lamichhane G, Zignol M, Blades NJ, Geiman DE, Dougherty A, Grosset J, Broman KW, Bishai WR,
A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis.
Proc Natl Acad Sci U S A (2003) 100 :7213
Mattow J, Schaible UE, Schmidt F, Hagens K, Siejak F, Brestrich G, Haeselbarth G, Muller EC, Jungblut PR, Kaufmann SH,
Comparative proteome analysis of culture supernatant proteins from virulent Mycobacterium tuberculosis H37Rv and attenuated M. bovis BCG Copenhagen.
Electrophoresis (2003) 24 (19-20):3405-20
Marmiesse M, Brodin P, Buchrieser C, Gutierrez C, Simoes N, Vincent V, Glaser P, Cole ST, Brosch R,
Macro-array and bioinformatic analyses reveal mycobacterial 'core' genes, variation in the ESAT-6 gene family and new phylogenetic markers for the Mycobacterium tuberculosis complex.
Microbiology (2004) 150 (Pt 2):483-96
Mawuenyega KG, Forst CV, Dobos KM, Belisle JT, Chen J, Bradbury EM, Bradbury AR, Chen X,
Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling.
Mol Biol Cell (2005) 16(1):396-404
Rengarajan J, Bloom BR, Rubin EJ,
Genome-wide requirements for Mycobacterium tuberculosis adaptation and survival in macrophages.
Proc Natl Acad Sci U S A (2005) 102:8327
Fernandez P, Saint-Joanis B, Barilone N, Jackson M, Gicquel B, Cole ST, Alzari PM,
The Ser/Thr protein kinase PknB is essential for sustaining mycobacterial growth
J Bacteriol (2006) 188:7778