| ![]() |
| To navigate upstream or downstream, click on the first or last gene | Download image in PDF format |
| Functional category | regulatory proteins |
| Proteomics | Identified by proteomics at the Max Planck Institute for Infection Biology, Berlin, Germany and the Statens Serum Institute (Denmark) (see Jungblut et al., 1999). Identified in the culture supernatant of M. tuberculosis H37Rv using mass spectrometry (See Mattow et al., 2003). Identified in the cytosol of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). |
| Transcriptome | mRNA identified by microarray analysis and down-regulated after 96h of starvation (see Betts et al., 2002). |
| Mutation | non essential gene by Himar1-based transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Required for survival in primary murine macrophages, by transposon site hybridization (TraSH) in H37Rv (See Rengarajan et al., 2005). mutants available at TARGET website |
| Annotation Changes | proteomics, bibliography updated on 01-JUL-2009 |
| Coordinates | |||
|---|---|---|---|
| Type | Start | End | Orientation | CDS | 23861 | 25444 | - |
| Protein sequence in FASTA format | ||
|---|---|---|
| >M. tuberculosis H37Rv | fhaA MGSQKRLVQRVERKLEQTVGDAFARIFGGSIVPQEVEALLRREAADGIQSLQGNRLLAPNEYIITLGVHDFEKLGADPEL KSTGFARDLADYIQEQGWQTYGDVVVRFEQSSNLHTGQFRARGTVNPDVETHPPVIDCARPQSNHAFGAEPGVAPMSDNS SYRGGQGQGRPDEYYDDRYARPQEDPRGGPDPQGGSDPRGGYPPETGGYPPQPGYPRPRHPDQGDYPEQIGYPDQGGYPE QRGYPEQRGYPDQRGYQDQGRGYPDQGQGGYPPPYEQRPPVSPGPAAGYGAPGYDQGYRQSGGYGPSPGGGQPGYGGYGE YGRGPARHEEGSYVPSGPPGPPEQRPAYPDQGGYDQGYQQGATTYGRQDYGGGADYTRYTESPRVPGYAPQGGGYAEPAG RDYDYGQSGAPDYGQPAPGGYSGYGQGGYGSAGTSVTLQLDDGSGRTYQLREGSNIIGRGQDAQFRLPDTGVSRRHLEIR WDGQVALLADLNSTNGTTVNNAPVQEWQLADGDVIRLGHSEIIVRMH* | ||
| Blastp: results | ||
| TransMembrane prediction using Hidden Markov Models: tmhmm | ||
| Microbe Genome Browser | ||
| Genomic sequence | ||
| Structural information | ||
|---|---|---|
| Protein Data Bank | No structure available | |
| PFAM | Protein Family Domains | |
| Orthologs/Cross-references | ||
|---|---|---|
| CDC1551 | MT0023 | |
| Mbovis | Mb0020c | |
| Mleprae | ML0022 | |
| Msmegmatis | MSMEG_0035 | |
| UniProt | P71590 | |
| Interacting Drugs/Compounds | ||
|---|---|---|
| TDR Targets | Rv0020c | |
| Expression Data | ||
|---|---|---|
| TBDB | Rv0020c | |
| Bibliography | ||
|---|---|---|
| Jungblut PR, Schaible UE, Mollenkopf HJ, Zimny-Arndt U, Raupach B, Mattow J, Halada P, Lamer S, Hagens K, Kaufmann SH, Comparative proteome analysis of Mycobacterium tuberculosis and Mycobacterium bovis BCG strains: towards functional genomics of microbial pathogens Mol Microbiol (1999) 33(6):1103-17 | ||
| Rosenkrands I, Weldingh K, Jacobsen S, Hansen CV, Florio W, Gianetri I, Andersen P, Mapping and identification of Mycobacterium tuberculosis proteins by two-dimensional gel electrophoresis, microsequencing and immunodetection Electrophoresis (2000) 21(5):935-48 | ||
| Rosenkrands I, King A, Weldingh K, Moniatte M, Moertz E, Andersen P, Towards the proteome of Mycobacterium tuberculosis Electrophoresis (2000) 21(17):3740-56 | ||
| Betts JC, Lukey PT, Robb LC, McAdam RA, Duncan K, Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling Mol Microbiol (2002) 43 :717 | ||
| Sassetti CM, Boyd DH, Rubin EJ, Genes required for mycobacterial growth defined by high density mutagenesis. Mol Microbiol (2003) 48(1):77-84 | ||
| Lamichhane G, Zignol M, Blades NJ, Geiman DE, Dougherty A, Grosset J, Broman KW, Bishai WR, A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Proc Natl Acad Sci U S A (2003) 100 :7213 | ||
| Mattow J, Schaible UE, Schmidt F, Hagens K, Siejak F, Brestrich G, Haeselbarth G, Muller EC, Jungblut PR, Kaufmann SH, Comparative proteome analysis of culture supernatant proteins from virulent Mycobacterium tuberculosis H37Rv and attenuated M. bovis BCG Copenhagen. Electrophoresis (2003) 24 (19-20):3405-20 | ||
| Marmiesse M, Brodin P, Buchrieser C, Gutierrez C, Simoes N, Vincent V, Glaser P, Cole ST, Brosch R, Macro-array and bioinformatic analyses reveal mycobacterial 'core' genes, variation in the ESAT-6 gene family and new phylogenetic markers for the Mycobacterium tuberculosis complex. Microbiology (2004) 150 (Pt 2):483-96 | ||
| Mawuenyega KG, Forst CV, Dobos KM, Belisle JT, Chen J, Bradbury EM, Bradbury AR, Chen X, Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Mol Biol Cell (2005) 16(1):396-404 | ||
| Rengarajan J, Bloom BR, Rubin EJ, Genome-wide requirements for Mycobacterium tuberculosis adaptation and survival in macrophages. Proc Natl Acad Sci U S A (2005) 102:8327 | ||
| Fernandez P, Saint-Joanis B, Barilone N, Jackson M, Gicquel B, Cole ST, Alzari PM, The Ser/Thr protein kinase PknB is essential for sustaining mycobacterial growth J Bacteriol (2006) 188:7778 | ||