Quick Search

Enter gene name or accession number


Search term: Rv3769

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv3769
Rv numberRv3769
TypeCDS
FunctionUnknown
ProductHypothetical protein
CommentsRv3769, (MTCY13D12.03), len: 90 aa. Hypothetical unknown protein, possible coiled-coil protein.
Molecular mass (Da)9720.97
Isoelectric point9.1589
Gene length (bp)273
Protein length90
Location (kb)4214.62


Functional categoryconserved hypotheticals


Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Found to be deleted (partially or completely) in one or more clinical isolates (See Tsolaki et al., 2004). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS42146154214887+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv3769|Rv3769
VTTLKELGARVAALEANQADYRAVLAAVNPPGANQREIATTVREHTGRLDRVTTKVGQLA
AKSDDTNARVRSLEEGQAEIKDLLLRALDK
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
M. bovisMb3795
M. marinumMMAR_4959
UniProtP72036
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv3769


Expression Data
TBDBRv3769


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Tsolaki AG, Hirsh AE, DeRiemer K, Enciso JA, Wong MZ, Hannan M, Goguet de la Salmoniere YO, Aman K, Kato-Maeda M, Small PM,
Functional and evolutionary genomics of Mycobacterium tuberculosis: insights from genomic deletions in 100 strains.
Proc Natl Acad Sci U S A (2004) 101(14):4865-70
Cited for: Mutant