Quick Search

Enter gene name or accession number


Search term: Rv3767c

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv3767c
Rv numberRv3767c
TypeCDS
FunctionPossible methyltransferase
ProductPossible S-adenosylmethionine-dependent methyltransferase
CommentsRv3767c, (MTV025.115c, MTCY13D12.01), len: 314 aa. Possible S-adenosylmethionine-dependent methyltransferase (see Grana et al., 2007), similar to other Mycobacterium tuberculosis hypothetical proteins e.g. P96823|Rv0146|MTCI5.20 34.0 KDA protein (310 aa), FASTA scores: opt: 909, E(): 5.3e-50, (48.1% identity in 316 aa overlap); O53686|Rv0281|MTV035.09 (302 aa), FASTA scores: opt: 802, E(): 2.8e-43, (45.2% identity in 314 aa overlap); Q50726|YX99_MYCTU|Rv3399|MT3507|MTCY78.29c (348 aa), FASTA scores: opt: 796, E(): 7.6e-43, (45.35% identity in 302 aa overlap); MTCY78_30; MTCY31_23; MTCY210_45; MTCY4C12_14; MTY13D12_21, MTCI5_19; MTCY180_22; etc. Contains probable N-terminal signal sequence
Molecular mass (Da)34723.2
Isoelectric point4.6961
Gene length (bp)945
Protein length314
Location (kb)4213


Functional categorylipid metabolism


ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
TranscriptomeDNA microarrays show higher level of expression in M. tuberculosis H37Rv than in phoP|Rv0757 mutant (See Walters et al., 2006).
MutationNon-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Found to be deleted (partially or completely) in one or more clinical isolates (See Tsolaki et al., 2004). Check for mutants available at TARGET website
RegulonPredicted to be in the SigE|Rv1221 regulon during macrophage (THP-1) infection (See Fontan et al., 2008).


Coordinates
TypeStartEndOrientation
CDS42129964213940-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv3767c|Rv3767c
VPRTDNDSWAITESVGATALGVAAARAAETESDNPLINDPFARIFVDAAGDGIWSMYTNR
TLLAGATDLDPDLRAPIQQMIDFMAARTAFFDEYFLATADAGVRQVVILASGLDSRAWRL
PWPDGTVVYELDQPKVLEFKSATLRQHGAQPASQLVNVPIDLRQDWPKALQKAGFDPSKP
CAWLAEGLVRYLPARAQDLLFERIDALSRPGSWLASNVPGAGFLDPERMRRQRADMRRMR
AAAAKLVETEISDVDDLWYAEQRTAVAEWLRERGWDVSTATLPELLARYGRSIPHSGEDS
IPPNLFVSAQRATS
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMO86359


Orthologs/Cross-references
CDC1551MT3874
Enzyme Classification2.1.1.-
Gene Ontologymethyltransferase activity
M. bovisMb3793c
M. lepraeML0123
M. marinumMMAR_5323
UniProtO86359
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv3767c


Expression Data
TBDBRv3767c


Bibliography
Gu S, Chen J, Dobos KM, Bradbury EM, Belisle JT, Chen X,
Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain.
Mol Cell Proteomics (2003) 2(12):1284-96
Cited for: Proteomics
Tsolaki AG, Hirsh AE, DeRiemer K, Enciso JA, Wong MZ, Hannan M, Goguet de la Salmoniere YO, Aman K, Kato-Maeda M, Small PM,
Functional and evolutionary genomics of Mycobacterium tuberculosis: insights from genomic deletions in 100 strains.
Proc Natl Acad Sci U S A (2004) 101(14):4865-70
Cited for: Mutant
Walters SB, Dubnau E, Kolesnikova I, Laval F, Daffe M, Smith I,
The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis.
Mol Microbiol (2006) 60(2):312-30
Cited for: Transcriptome
Grana M, Haouz A, Buschiazzo A, Miras I, Wehenkel A, Bondet V, Shepard W, Schaeffer F, Cole ST, Alzari PM,
The crystal structure of M. leprae ML2640c defines a large family of putative S-adenosylmethionine-dependent methyltransferases in mycobacteria.
Protein Sci (2007) 16(9):1896-904
Cited for: Function
Fontan PA, Aris V, Alvarez ME, Ghanny S, Cheng J, Soteropoulos P, Trevani A, Pine R, Smith I,
Mycobacterium tuberculosis sigma factor E regulon modulates the host inflammatory response.
J Infect Dis (2008) 198(6):877-85
Cited for: Regulon
Malen H, Pathak S, Softeland T, de Souza GA, Wiker HG,
Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv.
BMC Microbiol (2010) 10:132
Cited for: Proteomics
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant