Quick Search

Enter gene name or accession number


Search term: Rv3766

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv3766
Rv numberRv3766
TypeCDS
FunctionUnknown
ProductHypothetical protein
CommentsRv3766, (MTV025.114), len: 229 aa. Hypothetical unknown protein. Segment 183 to 229 highly similar to C-terminal part of O06288|Rv3594|MTCY07H7B.28c conserved hypothetical protein from Mycobacterium tuberculosis (275 aa), FASTA scores: opt: 128, E(): 0.92, (46.8% identity in 47 aa overlap).
Molecular mass (Da)24605.5
Isoelectric point4.7365
Gene length (bp)690
Protein length229
Location (kb)4212.29


Functional categoryconserved hypotheticals


ProteomicsIdentified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Found to be deleted (partially or completely) in one or more clinical isolates (See Tsolaki et al., 2004). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS42122934212982+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv3766|Rv3766
MRSAFDSGRLTFGIVYTYARPNWWANANTVRSMIDAAGGLHPRVALMLDVESGGNPPGDG
SSWINRLYWNLADYAGSPVRIIGYANAYDFFNMWRVRPAGLRVIGAGYGSNPNLPGQVAH
QYTDGSGYSPNLPQGAPPFGRCDMNSANGLTPQQFAAACGVTTTGGPLMALTDEEQTELL
TKVREIWDQLRGPNGAGWPQLGQNEQGQDLTPVDAIAVIKNDVAAMLAE
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
CDC1551MT3873
M. bovisMb3792
M. lepraeML2360
UniProtO69731
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv3766


Expression Data
TBDBRv3766


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Tsolaki AG, Hirsh AE, DeRiemer K, Enciso JA, Wong MZ, Hannan M, Goguet de la Salmoniere YO, Aman K, Kato-Maeda M, Small PM,
Functional and evolutionary genomics of Mycobacterium tuberculosis: insights from genomic deletions in 100 strains.
Proc Natl Acad Sci U S A (2004) 101(14):4865-70
Cited for: Mutant
Kruh NA, Troudt J, Izzo A, Prenni J, Dobos KM,
Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo.
PLoS One (2010) 5(11):e13938
Cited for: Proteomics
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant