Quick Search

Enter gene name or accession number


Search term: Rv3765c

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nametcrX
Rv numberRv3765c
TypeCDS
FunctionSensor part of a two component regulatory system.
ProductProbable two component transcriptional regulatory protein TcrX
CommentsRv3765c, (MTV025.113c), len: 234 aa. Probable tcrX, response regulator of a two-component regulatory system, highly similar to others e.g. Q9ADN7|2SC10A7.24 putative two component system response regulator from Streptomyces coelicolor (271 aa), FASTA scores: opt: 1111, E(): 4.8e-63, (72.3% identity in 231 aa overlap); Q9F161 response regulator from Corynebacterium glutamicum (Brevibacterium flavum) (232 aa), FASTA scores: opt: 692, E(): 1.2e-36, (46.0% identity in 226 aa overlap); Q9KZU5|SCD84.23c putative two-component systen response regulator from Streptomyces coelicolor (248 aa), FASTA scores: opt: 674, E(): 1.7e-35, (44.05% identity in 236 aa overlap); etc. Also highly similar to others from Mycobacterium tuberculosis e.g. Q50806|Rv1033c|MTCY10G2.16 response regulator homolog (257 aa), FASTA scores: opt: 947, E(): 1e-52, (59.5% identity in 232 aa overlap); P71814|Rv0757|MTCY369.02 PHOP-like protein (247 aa) FASTA scores: opt: 829, E(): 2.8e-45, (54.65% identity in 225 aa overlap); O53894|Rv0981|MTV044.09 (230 aa), FASTA scores: opt: 662, E(): 9e-35, (44.65% identity in 224 aa overlap); and also similar to MTCY31_34; MTCY19H5_20; MTY13628_5; MTCY20G9_17; and to MLCB57_27 from Mycobacterium leprae; and MBY13627_3 from Mycobacterium bovis BCG. Equivalent to AAK48236 from Mycobacterium tuberculosis strain CDC1551 (286 aa) but shorter 52 aa. The N-terminal region is similar to that of other regulatory components of sensory transduction systems. Similar to bacterial regulatory proteins involved in signal transduction.
Molecular mass (Da)25843.8
Isoelectric point5.7389
Gene length (bp)705
Protein length234
Location (kb)4211.08


Functional categoryregulatory proteins


Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Found to be deleted (partially or completely) in one or more clinical isolates (See Tsolaki et al., 2004). M. tuberculosis H37Rv tcrXY mutant shows increased virulence in SCID mice (See Parish et al., 2004).
see TB knockouts/mutants availability


Coordinates
TypeStartEndOrientation
CDS42110804211784-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv3765c|tcrX
MRRADGQPVTVLVVDDEPVLAEMVSMALRYEGWNITTAGDGSSAIAAARRQRPDVVVLDV
MLPDMSGLDVLHKLRSENPGLPVLLLTAKDAVEDRIAGLTAGGDDYVTKPFSIEEVVLRL
RALLRRTGVTTVDSGAQLVVGDLVLDEDSHEVMRAGEPVSLTSTEFELLRFMMHNSKRVL
SKAQILDRVWSYDFGGRSNIVELYISYLRKKIDNGREPMIHTLRGAGYVLKPAR
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMO69730


Orthologs/Cross-references
CDC1551MT3872
Gene Ontologytwo-component response regulator activity
two-component signal transduction system (phosphorelay)
DNA binding
regulation of transcription, DNA-dependent
M. bovisMb3791c
M. lepraeML2361
M. smegmatisMSMEG_4990
UniProtO69730
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv3765c


Expression Data
TBDBRv3765c


Bibliography
Parish T, Smith DA, Kendall S, Casali N, Bancroft GJ, Stoker NG,
Deletion of two-component regulatory systems increases the virulence of Mycobacterium tuberculosis.
Infect Immun (2003) 71(3):1134-40
Cited for: Mutant/Secondary/Function
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Tsolaki AG, Hirsh AE, DeRiemer K, Enciso JA, Wong MZ, Hannan M, Goguet de la Salmoniere YO, Aman K, Kato-Maeda M, Small PM,
Functional and evolutionary genomics of Mycobacterium tuberculosis: insights from genomic deletions in 100 strains.
Proc Natl Acad Sci U S A (2004) 101(14):4865-70
Cited for: Mutant
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant