Quick Search

Enter gene name or accession number


Search term: Rv3764c

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nametcrY
Rv numberRv3764c
TypeCDS
FunctionSensor part of a two component regulatory system.
ProductPossible two component sensor kinase TcrY
CommentsRv3764c, (MTV025.112c), len: 475 aa. Possible tcrY, histidine protein kinase, part of a two-component regulatory system, similar to others e.g. Q9ADN6|2SC10A7.25 putative two component system histidine kinase from Streptomyces coelicolor (524 aa), FASTA scores: opt: 1332, E(): 5.4e-70, (49.9% identity in 477 aa overlap); Q9L3C1|KB|CAC42479 putative histidine kinase from Amycolatopsis mediterranei (469 aa), FASTA scores: opt: 515, E(): 1.4e-22, (36.1% identity in 313 aa overlap); P72560 histidine protein kinase from Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) (438 aa), FASTA scores: opt: 480, E(): 1.4e-20, (40.1% identity in 232 aa overlap); P30847|P76401|BAES_ECOLI|B2078 sensor protein from Escherichia coli strain K12 (467 aa); etc. Also similar to others from Mycobacterium tuberculosis e.g. P96368|Rv1032c|MTCY10G2.17 (509 aa), FASTA scores: opt: 1007, E(): 4e-51, (43.5% identity in 416 aa overlap); and P71815|Rv0758|MTCY369.03 (485 aa), FASTA scores: opt: 738, E(): 1.6e-35, (28.6% identity in 438 aa overlap). Equivalent to AAK48235 from Mycobacterium tuberculosis strain CDC1551 (506 aa) but shorter 31 aa.
Molecular mass (Da)50312.4
Isoelectric point7.5042
Gene length (bp)1428
Protein length475
Location (kb)4209.58


Functional categoryregulatory proteins


ProteomicsIdentified in the cytosol and cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Found to be deleted (partially or completely) in one or more clinical isolates (See Tsolaki et al., 2004). M. tuberculosis H37Rv tcrXY mutant shows increased virulence in SCID mice (See Parish et al., 2004).
see TB knockouts/mutants availability


Coordinates
TypeStartEndOrientation
CDS42095824211009-
RBS42110154211018-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv3764c|tcrY
VGITAATEMALRRHLVAQLDNQLGGTSYRSVLMYPEKMPRPPWRHETHNYIRSGPGPRFL
DAPGQPAGMVAAVVSDGTTVAAGYLTGSGSRAALTSTGRSQLERIAGSRTPLTLDLDGLG
RYRVLAAPSRNGHDVIVTGLSMGNVDATMLQMLIIFGIVTVIALVAATTAGIVIIKRALA
PLRRVAQTASEVVDLPLDRGEVKLPVRVPEPDANPSTEVGQLGSALNRMLDHIAAALSAR
QASETCVRQFVADASHELRTPLAAIRGYTELTQRIGDDPEAVAHAMSRVASETERITRLV
EDLLLLARLDSGRPLERGPVDMSRLAVDAVSDAHVAGPDHQWALDLPPEPVVIPGDAARL
HQVVTNLLANARVHTGPGTIVTTRLSTGPTHVVLQVIDNGPGIPAALQSEVFERFARGDT
SRSRQAGSTGLGLAIVSAVVKAHNGTITVSSSPGYTEFAVRLPLDGWQPLESSPR
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMO69729


Orthologs/Cross-references
CDC1551MT3871
Enzyme Classification2.7.13.3
Gene Ontologytwo-component sensor activity
two-component signal transduction system (phosphorelay)
ATP binding
signal transduction
integral to membrane
peptidyl-histidine phosphorylation
M. bovisMb3790c
M. lepraeML2362
M. marinumMMAR_5316
M. smegmatisMSMEG_4989
UniProtO69729
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv3764c


Expression Data
TBDBRv3764c


Bibliography
Parish T, Smith DA, Kendall S, Casali N, Bancroft GJ, Stoker NG,
Deletion of two-component regulatory systems increases the virulence of Mycobacterium tuberculosis.
Infect Immun (2003) 71(3):1134-40
Cited for: Mutant/Secondary/Function
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Tsolaki AG, Hirsh AE, DeRiemer K, Enciso JA, Wong MZ, Hannan M, Goguet de la Salmoniere YO, Aman K, Kato-Maeda M, Small PM,
Functional and evolutionary genomics of Mycobacterium tuberculosis: insights from genomic deletions in 100 strains.
Proc Natl Acad Sci U S A (2004) 101(14):4865-70
Cited for: Mutant
Mawuenyega KG, Forst CV, Dobos KM, Belisle JT, Chen J, Bradbury EM, Bradbury AR, Chen X,
Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling.
Mol Biol Cell (2005) 16(1):396-404
Cited for: Proteomics
Malen H, Pathak S, Softeland T, de Souza GA, Wiker HG,
Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv.
BMC Microbiol (2010) 10:132
Cited for: Proteomics
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant