Quick Search

Enter gene name or accession number


Search term: Rv3763

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene namelpqH
Rv numberRv3763
TypeCDS
FunctionShown to inhibit gamma interferon regulated HLA-DR protein and mRNA expression in human macrophages
Product19 kDa lipoprotein antigen precursor LpqH
CommentsRv3763, (MTV025.111), len: 159 aa. LpqH, conserved 19 KDa lipoprotein antigen precursor (see citations below), equivalent to P31502|19KD_MYCIT|MI22 19 KDA lipoprotein antigen precursor (MI22 antigen) from Mycobacterium intracellulare (162 aa), FASTA scores: opt: 773, E(): 6.2e-35, 75.95(% identity in 162 aa overlap); P46733|19KD_MYCAV 19 KDA lipoprotein antigen precursor from Mycobacterium avium (161 aa), FASTA scores: opt: 743, E(): 2.5e-33, (72.5% identity in 160 aa overlap); and Q9X7A5|LPQH|ML1966 possible lipoprotein from Mycobacterium leprae FASTA scores: opt: 371, E(): 2.2e-13, (42.6% identity in 162 aa overlap). Possibly attached to the membrane by a lipid anchor. Similar to other mycobacterium 19 KDA antigen. Contains PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
Molecular mass (Da)15114.8
Isoelectric point7.1813
Gene length (bp)480
Protein length159
Location (kb)4209.05


Functional categorycell wall and cell processes


ProteomicsThe product of this CDS corresponds to spots 19kDa or 3763 identified in short term culture filtrate and cell wall by proteomics at the Statens Serum Institute (Denmark) (see proteomics citations). Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS (See Xiong et al., 2005). Identified in the detergent phase of Triton X-114 extracts of M. tuberculosis H37Rv membranes using CEGE and MALDI-TOF-MS (See Sinha et al., 2005). Putative glycoprotein identified by LC/ESI-MS/MS in the culture filtrate of M. tuberculosis H37Rv (See Gonzalez-Zamorano et al., 2009). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011).
TranscriptomemRNA identified by microarray analysis and up-regulated after 4h of starvation (see Betts et al., 2002).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Found to be deleted (partially or completely) in one or more clinical isolates (See Tsolaki et al., 2004). Check for mutants available at TARGET website
RegulonPredicted to be in the RelA|Rv2583c regulon (See Dahl et al., 2003).


Coordinates
TypeStartEndOrientation
RBS42090354209040+
CDS42090474209526+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv3763|lpqH
VKRGLTVAVAGAAILVAGLSGCSSNKSTTGSGETTTAAGTTASPGAASGPKVVIDGKDQN
VTGSVVCTTAAGNVNIAIGGAATGIAAVLTDGNPPEVKSVGLGNVNGVTLGYTSGTGQGN
ASATKDGSHYKITGTATGVDMANPMSPVNKSFEIEVTCS
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMP0A5J0


Orthologs/Cross-references
CDC1551MT3870
Gene Ontologyplasma membrane
M. bovisMb3789
M. lepraeML1966
M. marinumMMAR_5315
M. smegmatisMSMEG_6316
UniProtP0A5J0
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv3763


Expression Data
TBDBRv3763


Bibliography
Rosenkrands I, Weldingh K, Jacobsen S, Hansen CV, Florio W, Gianetri I, Andersen P,
Mapping and identification of Mycobacterium tuberculosis proteins by two-dimensional gel electrophoresis, microsequencing and immunodetection
Electrophoresis (2000) 21(5):935-48
Cited for: Proteomics
Rosenkrands I, King A, Weldingh K, Moniatte M, Moertz E, Andersen P,
Towards the proteome of Mycobacterium tuberculosis
Electrophoresis (2000) 21(17):3740-56
Cited for: Proteomics
Betts JC, Lukey PT, Robb LC, McAdam RA, Duncan K,
Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling
Mol Microbiol (2002) 43(3):717-31
Cited for: Transcriptome
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Pai RK, Convery M, Hamilton TA, Boom WH, Harding CV,
Inhibition of IFN-gamma-induced class II transactivator expression by a 19-kDa lipoprotein from Mycobacterium tuberculosis: a potential mechanism for immune evasion.
J Immunol (2003) 171(1):175-84
Cited for: Product/Function
Gehring AJ, Rojas RE, Canaday DH, Lakey DL, Harding CV, Boom WH,
The Mycobacterium tuberculosis 19-kilodalton lipoprotein inhibits gamma interferon-regulated HLA-DR and Fc gamma R1 on human macrophages through Toll-like receptor 2.
Infect Immun (2003) 71(8):4487-97
Cited for: Product/Function
Dahl JL, Kraus CN, Boshoff HI, Doan B, Foley K, Avarbock D, Kaplan G, Mizrahi V, Rubin H, Barry CE 3rd,
The role of RelMtb-mediated adaptation to stationary phase in long-term persistence of Mycobacterium tuberculosis in mice.
Proc Natl Acad Sci U S A (2003) 100(17):10026-31
Cited for: Regulon
Gu S, Chen J, Dobos KM, Bradbury EM, Belisle JT, Chen X,
Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain.
Mol Cell Proteomics (2003) 2(12):1284-96
Cited for: Proteomics
Tsolaki AG, Hirsh AE, DeRiemer K, Enciso JA, Wong MZ, Hannan M, Goguet de la Salmoniere YO, Aman K, Kato-Maeda M, Small PM,
Functional and evolutionary genomics of Mycobacterium tuberculosis: insights from genomic deletions in 100 strains.
Proc Natl Acad Sci U S A (2004) 101(14):4865-70
Cited for: Mutant
Xiong Y, Chalmers MJ, Gao FP, Cross TA, Marshall AG,
Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry.
J Proteome Res (2005) 4(3):855-61
Cited for: Proteomics
Sinha S, Kosalai K, Arora S, Namane A, Sharma P, Gaikwad AN, Brodin P, Cole ST,
Immunogenic membrane-associated proteins of Mycobacterium tuberculosis revealed by proteomics.
Microbiology (2005) 151(Pt 7):2411-9
Cited for: Proteomics
Gonzalez-Zamorano M, Mendoza-Hernandez G, Xolalpa W, Parada C, Vallecillo AJ, Bigi F, Espitia C,
Mycobacterium tuberculosis glycoproteomics based on ConA-lectin affinity capture of mannosylated proteins.
J Proteome Res (2009) 8(2):721-33
Cited for: Proteomics
Malen H, Pathak S, Softeland T, de Souza GA, Wiker HG,
Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv.
BMC Microbiol (2010) 10:132
Cited for: Proteomics
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant
Collins ME, Patki A, Wall S, Nolan A, Goodger J, Woodward MJ, Dale JW,
Cloning and characterization of the gene for the '19 kDa' antigen of Mycobacterium bovis
J Gen Microbiol (1990) 136(Pt 7):1429-36
Cited for: Homolog/Sequence/Product
Ashbridge KR, Booth RJ, Watson JD, Lathigra RB,
Nucleotide sequence of the 19 kDa antigen gene from Mycobacterium tuberculosis
Nucleic Acids Res (1989) 17(3):1249
Cited for: Sequence
Young D, Lathigra R, Hendrix R, Sweetser D, Young RA,
Stress proteins are immune targets in leprosy and tuberculosis
Proc Natl Acad Sci U S A (1988) 85(12):4267-70
Cited for: Product/Secondary
Booth RJ, Williams DL, Moudgil KD, Noonan LC, Grandison PM, McKee JJ, Prestidge RL, Watson JD,
Homologs of Mycobacterium leprae 18-kilodalton and Mycobacterium tuberculosis 19-kilodalton antigens in other mycobacteria
Infect Immun (1993) 61(4):1509-15
Cited for: Homolog/Secondary