Quick Search

Enter gene name or accession number


Search term: Rv3762c

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv3762c
Rv numberRv3762c
TypeCDS
FunctionFunction unknown; probably involved in cellular metabolism.
ProductPossible hydrolase
CommentsRv3762c, (MTV025.110c), len: 626 aa. Possible hydrolase, highly similar to hypothetical proteins and beta-lactamases e.g. Q9RL04|SC5G9.23 hypothetical 70.3 KDA protein from Streptomyces coelicolor (648 aa), FASTA scores: opt: 2088, E(): 3.7e-124, (52.9% identity in 624 aa overlap); P32717|YJCS_ECOLI|B4083 hypothetical 73.2 KDA protein from Escherichia coli strain K12 (661 aa), FASTA scores: opt: 1911, E(): 5.7e-113, (46.9% identity in 631 aa overlap); Q9A824|CC1540 metallo-beta-lactamase family protein from Caulobacter crescentus (647 aa), FASTA scores: opt: 1891, E(): 1e-111, (48.55% identity in 628 aa overlap); Q08347|YOL164W chromosome xv reading frame ORF from Saccharomyces cerevisiae (Baker's yeast) (646 aa) FASTA scores: opt: 1829, E(): 8.4e-108, (45.7% identity in 615 aa overlap); Q9I5I9|PA0740 probable beta-lactamase from Pseudomonas aeruginosa (658 aa), FASTA scores: opt: 1699, E(): 1.4e-99, (43.15% identity in 630 aa overlap); Q52556|SDSA alkyl sulfatase (protein involved in the degradation of sulfate esters of long-chain primaryal cohols e.g. SDS sodium dodecyl sulfate) from Pseudomonas sp (528 aa), FASTA scores: opt: 841, E(): 1.7e-45, (33.7% identity in 534 aa overlap); etc. N-terminual end also highly similar to Q48790|SEPA SEPA protein (protein implicated in cell separation) from Listeria monocytogenes (391 aa), FASTA scores: opt: 1256, E(): 8.3e-72, (49.6% identity in 363 aa overlap). Also slight similarity to P96253|Rv0407|MTCY22G10.03 hypothetical 37.0 KDA protein from Mycobacterium tuberculosis (336 aa).
Molecular mass (Da)68451
Isoelectric point5.0529
Gene length (bp)1881
Protein length626
Location (kb)4207


Functional categoryintermediary metabolism and respiration


ProteomicsIdentified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 90 days but not 30 days (See Kruh et al., 2010). Translational start site supported by proteomics data (See Kelkar et al., 2011).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website
RegulonPredicted to be in the RelA|Rv2583c regulon (See Dahl et al., 2003).


Coordinates
TypeStartEndOrientation
CDS42069964208876-
RBS42088844208887-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv3762c|Rv3762c
VPMEHKPPTAVIQAAHGEHSLPLHDTTDFDDADRGFIAALSPCVIKAADGRVVWDNDAYS
FLDGAAPTSVHPSLWRQSQLTAKQGLYQVVPGIYQVRGFDISNISFVEGDTGLIVIDPLV
STEVAAAALDLYRAHRGADRPVVAVIYTHSHVDHFGGVLGVTTQADVDAGKVAVLAPEGF
TAHAVQENIYAGSAMMRRAGYMYGTVLARGLRGHVGCGLGQTLSTGEVSLVVPTVDITET
GETHTIDGVEIEFQMAPGTEAPAEMHFYFPRFRALCMAENATHNLHNLLTLRGALVRDPR
AWSGYLTEAIDTFADRTDVVFASHHWPTWGREKIVEFLSQQRDMYSYLHDQTLRLLNQGY
TGVEIAEMFQLPPALQRAWHTHGYYGSVSHNVKAIYQRYMGWFDGNPGWLWPHPPEALAP
RYVDALGGIDRVLELAREAFDAGDFRWAATLLDHAVFADSEHAAARGLYADTLEQLAYGA
ECATWRNFFLTGAAELRDGNPGSSGQVPAPTFFAQLTPDQIFDVLAISINGPRAWDLDLA
IDFTFTEPDVNYRLTLRNGVLIHRKLPADPATANATVTVGDKVRLVAAALGDISSPGFEV
FGDRTVLQTFLSVLDRPDSAFNIVTP
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
CDC1551MT3869
Enzyme Classification3.-.-.-
Gene Ontologyhydrolase activity
M. bovisMb3788c
M. lepraeML2364
M. marinumMMAR_5314
M. smegmatisMSMEG_6339
UniProtO69728
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv3762c


Expression Data
TBDBRv3762c


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Lamichhane G, Zignol M, Blades NJ, Geiman DE, Dougherty A, Grosset J, Broman KW, Bishai WR,
A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis.
Proc Natl Acad Sci U S A (2003) 100(12):7213-8
Cited for: Mutant
Dahl JL, Kraus CN, Boshoff HI, Doan B, Foley K, Avarbock D, Kaplan G, Mizrahi V, Rubin H, Barry CE 3rd,
The role of RelMtb-mediated adaptation to stationary phase in long-term persistence of Mycobacterium tuberculosis in mice.
Proc Natl Acad Sci U S A (2003) 100(17):10026-31
Cited for: Regulon
Kruh NA, Troudt J, Izzo A, Prenni J, Dobos KM,
Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo.
PLoS One (2010) 5(11):e13938
Cited for: Proteomics
Kelkar DS, Kumar D, Kumar P, Balakrishnan L, Muthusamy B, Yadav AK, Shrivastava P, Marimuthu A, Anand S, Sundaram H, Kingsbury R, Harsha HC, Nair B, Prasad TS, Chauhan DS, Katoch K, Katoch VM, Kumar P, Chaerkady R, Ramachandran S, Dash D, Pandey A,
Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
Mol Cell Proteomics (2011) 10(12):M111.011627
Cited for: Proteomics/Sequence
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant