Quick Search

Enter gene name or accession number


Search term: Rv3761c

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene namefadE36
Rv numberRv3761c
TypeCDS
FunctionFunction unknown, but possibly involvement in lipid degradation.
ProductPossible acyl-CoA dehydrogenase FadE36
CommentsRv3761c, (MTV025.109c), len: 351 aa. Possible fadE36, acyl-CoA dehydrogenase, similar to many conserved hypothetical proteins and showing some similarity with few acyl-CoA dehydrogenases, e.g. Q9APX7|FADE36 FADE36 protein from Pseudomonas aeruginosa (360 aa), FASTA scores: opt: 147, E(): 0.046, (26.15% identity in 214 aa overlap); part of AAB52261.2|U97002 protein similar to acyl-CoA dehydrogenases and epoxide hydrolases from Caenorhabditis elegans (985 aa), FASTA score: (31.2% identity in 324 aa overlap). C-terminal part is highly similar to Q50095|U1740AK|MLU15183_45 hypothetical protein from Mycobacterium leprae cosmid B174 (122 aa), FASTA scores: opt: 341, E(): 7.3e-15, (57.6% identity in 99 aa overlap). Contains PS00339 Aminoacyl-transfer RNA synthetases class-II signature 2.
Molecular mass (Da)38532.7
Isoelectric point5.0128
Gene length (bp)1056
Protein length351
Location (kb)4205.86


Functional categorylipid metabolism


ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS42058624206917-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv3761c|fadE36
VTSVDRLDGLDLGALDRYLRSLGIGRDGELRGELISGGRSNLTFRVYDDASSWLVRRPPL
HGLTPSAHDMAREYRVVAALGDTPVPVARTISLCQDDSVLGAPFQVVEFVAGQVVRRRAE
LEALGSRSVIEGCVDALIRVLVDLHSIDPKAVGLSDFGKPDGYLERQVRRWGSQWELVRL
PDDHRDADISRLHLALQQAIPQQSRTSIVHGDYRIDNTILDTDDPCHVRAVVDWELSTLG
DPLSDAALMCVYRDPALDLIVHAQAAWTSPLLPAADELADRYSLVSGQPLGHWEFYMALA
YFKLAIIAAGIDYRRRMSEQAEGKDTAAESVPDVVAPLIARGLAEIAKKSG
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMO69727


Orthologs/Cross-references
CDC1551MT3868
Enzyme Classification1.3.99.-
Gene Ontologyoxidoreductase activity
oxidation reduction
M. bovisMb3787c
M. lepraeML2365
M. marinumMMAR_5304
M. smegmatisMSMEG_6337
UniProtO69727
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv3761c


Expression Data
TBDBRv3761c


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Gu S, Chen J, Dobos KM, Bradbury EM, Belisle JT, Chen X,
Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain.
Mol Cell Proteomics (2003) 2(12):1284-96
Cited for: Proteomics
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Kelkar DS, Kumar D, Kumar P, Balakrishnan L, Muthusamy B, Yadav AK, Shrivastava P, Marimuthu A, Anand S, Sundaram H, Kingsbury R, Harsha HC, Nair B, Prasad TS, Chauhan DS, Katoch K, Katoch VM, Kumar P, Chaerkady R, Ramachandran S, Dash D, Pandey A,
Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
Mol Cell Proteomics (2011) 10(12):M111.011627
Cited for: Proteomics/Sequence
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant
Chubb AJ, Woodman ZL, da Silva Tatley FM, Hoffmann HJ, Scholle RR, Ehlers MR,
Identification of Mycobacterium tuberculosis signal sequences that direct the export of a leaderless beta-lactamase gene product in Escherichia coli
Microbiology (1998) 144(Pt 6):1619-29
Cited for: Secretion