Quick Search

Enter gene name or accession number


Search term: Rv3760

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv3760
Rv numberRv3760
TypeCDS
FunctionUnknown
ProductPossible conserved membrane protein
CommentsRv3760, (MTV025.108), len: 100 aa. Possible conserved membrane protein, equivalent to Q50094|ML2366|MLCB12.11c putative membrane protein from Mycobacterium leprae (113 aa), FASTA scores: opt: 423, E(): 1.2e-20, (67.7% identity in 99 aa overlap). Also similar with Q9JST1|NMA2149 putative inner membrane hypothetical protein from Neisseria meningitidis (serogroup A) (104 aa), FASTA scores: opt: 113, E(): 0.95, (33.85% identity in 62 aa overlap); and showing similarity with Q9ZAX7 ABC transporter membrane protein subunit from Streptococcus mutans (498 aa), FASTA scores: opt: 108, E(): 6.7, (42.35% identity in 85 aa overlap) (similarity at C-terminus); and P33108|SECY_MICLU preprotein translocase SECY subunit from Micrococcus luteus (Micrococcus lysodeikticus) (436 aa), FASTA scores: opt: 106, E(): 8.2, (29.05% identity in 86 aa overlap). Equivalent to AAK48231 from Mycobacterium tuberculosis strain CDC1551 (117 aa) but shorter 17 aa.
Molecular mass (Da)10533.7
Isoelectric point12.5216
Gene length (bp)303
Protein length100
Location (kb)4205.54


Functional categorycell wall and cell processes


ProteomicsPredicted transmembrane protein - identified in culture filtrates of M. tuberculosis H37Rv; signal peptide predicted (See Malen et al., 2007). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website
RegulonChIP-chip indicates SigF|Rv3286c binds to the intergenic upstream region (See Rodrigue et al., 2007).


Coordinates
TypeStartEndOrientation
CDS42055384205840+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv3760|Rv3760
VPGSVPGKAPEEPPVKFTRAAAVWSALIVGFLILILLLIFIAQNTASAQFAFFGWRWSLP
LGVAILLAAVGGGLITVFAGTARILQLRRAAKKTHAAALR
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMO69726


Orthologs/Cross-references
CDC1551MT3867
M. bovisMb3786
M. lepraeML2366
M. marinumMMAR_5303
M. smegmatisMSMEG_6336
UniProtO69726
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv3760


Expression Data
TBDBRv3760


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Rodrigue S, Brodeur J, Jacques PE, Gervais AL, Brzezinski R, Gaudreau L,
Identification of mycobacterial sigma factor binding sites by chromatin immunoprecipitation assays.
J Bacteriol (2007) 189(5):1505-13
Cited for: Regulon
Malen H, Berven FS, Fladmark KE, Wiker HG,
Comprehensive analysis of exported proteins from Mycobacterium tuberculosis H37Rv.
Proteomics (2007) 7(10):1702-18
Cited for: Proteomics
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant