Quick Search

Enter gene name or accession number


Search term: Rv3730c

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv3730c
Rv numberRv3730c
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv3730c, (MTV025.078c), len: 346 aa. Conserved hypothetical protein, highly similar to Q9XAM1|SC4C6.19 hypothetical 38.5 KDA protein from Streptomyces coelicolor (341 aa), FASTA scores: opt: 1313, E(): 2.2e-75, (59.25% identity in 336 aa overlap); and similar to C-terminal end of putative ATP-dependent DNA ligases e.g. BAB49297|MLL2077 from Rhizobium loti (Mesorhizobium loti) (833 aa), FASTA scores: opt: 550, E(): 5.3e-27, (31.3% identity in 294 aa overlap); and BAB54816|MLL9625 from Rhizobium loti (Mesorhizobium loti) plasmid pMLb (883 aa) FASTA scores: opt: 492, E(): 2.5e-23, (33.7% identity in 291 aa overlap); etc. Also similar to the hypothetical proteins e.g. Q9ZC15|SC1E6.07 hypothetical 34.9 KDA protein from Streptomyces coelicolor (319 aa) FASTA scores: opt: 537, E(): 1.5e-26, (34.95% identity in 292 aa overlap); Q9XAF7|SC6G9.25 hypothetical 32.1 KDA protein from Streptomyces coelicolor (293 aa), FASTA scores: opt: 474, E(): 1.3e-22, (33.75% identity in 302 aa overlap); etc. Also highly similar to P95226|Rv0269c|MTCY06A4.13c hypothetical 44.0 KDA protein from Mycobacterium tuberculosis (397 aa), FASTA scores: opt: 940, E(): 7.7e-52, (50.3% identity in 312 aa overlap).
Molecular mass (Da)38543.7
Isoelectric point5.6964
Gene length (bp)1041
Protein length346
Location (kb)4180.68


Functional categoryconserved hypotheticals
Prediction based on GO and InterPro: intermediary metabolism and respiration (See Mazandu and Mulder, 2012)


ProteomicsIdentified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS41806804181720-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv3730c|Rv3730c
MAAAAEELDVDGIAVRLTSPDRMYFPKLGSHGTKRRLVEYYFAVAGGPMLTALRDRPTHL
QRFPDGVDGEQIYQKRIPRHRPDYLQTCRVTFPSGRMADALKVTHPAAIVWAAQMGTITL
HPWQVRCPDTEHPDELRIDLDPQPGTGFVEARTVAVDVLRSVLDDLGLVGYPKTSGGRGI
HVFLRIATDWDFVEVRRAGIALAREVERRAPDAVTTSWWKEERGARIFIDFNQNARDRTM
ASAYSVRPTPIATVSMPLTWEELAGADPDDYTMTTVPELVKIRDDPWAGMDDVAQSIAPL
LDLAAADEERGLGDMPYPPNYPKMPGEPKRVQPSRDTDLKGGNTSK
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMO69697


Orthologs/Cross-references
CDC1551MT3835
Gene OntologyDNA primase activity
DNA replication, synthesis of RNA primer
M. bovisMb3757c
M. lepraeML2342
M. marinumMMAR_5265
M. smegmatisMSMEG_6301
UniProtO69697
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv3730c


Expression Data
TBDBRv3730c


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Kruh NA, Troudt J, Izzo A, Prenni J, Dobos KM,
Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo.
PLoS One (2010) 5(11):e13938
Cited for: Proteomics
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Kelkar DS, Kumar D, Kumar P, Balakrishnan L, Muthusamy B, Yadav AK, Shrivastava P, Marimuthu A, Anand S, Sundaram H, Kingsbury R, Harsha HC, Nair B, Prasad TS, Chauhan DS, Katoch K, Katoch VM, Kumar P, Chaerkady R, Ramachandran S, Dash D, Pandey A,
Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
Mol Cell Proteomics (2011) 10(12):M111.011627
Cited for: Proteomics/Sequence
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant
Mazandu GK, Mulder NJ,
Function Prediction and Analysis of Mycobacterium tuberculosis Hypothetical Proteins.
Int J Mol Sci (2012) 13(6):7283-302
Cited for: Function