Quick Search

Enter gene name or accession number


Search term: Rv3708c

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameasd
Rv numberRv3708c
TypeCDS
FunctionInvolved at the second step in the common biosynthetic pathway leading from asp to the cell wall precursor MESO-diaminopimelate, to LYS, to met, to ILE and to THR [catalytic activity: L-aspartate-semialdehyde + orthophosphate + NADP(+) = L-aspartyl phosphate + NADPH].
ProductAspartate-semialdehyde dehydrogenase Asd (ASA dehydrogenase) (ASADH) (aspartic semialdehyde dehydrogenase) (L-aspartate-beta-semialdehyde dehydrogenase)
CommentsRv3708c, (MTV025.056c), len: 345 aa. Asd, aspartate-semialdehyde dehydrogenase (see citation below), equivalent to many e.g. P47730|DHAS_MYCBO|ASD from Mycobacterium bovis (345 aa) FASTA scores: opt: 2150, E(): 1.6e-124, (97.7% identity in 345 aa overlap); or Q9JN40|ASD from Mycobacterium bovis (323 aa), FASTA scores: opt: 2021, E(): 1.2e-116, (97.5% identity in 323 aa overlap); Q9CB78|ASD|ML2322 from Mycobacterium leprae (351 aa), FASTA scores: opt: 1889, E(): 1.6e-108, (84.45% identity in 347 aa overlap); P41404|DHAS_MYCSM|ASD from Mycobacterium smegmatis (346 aa), FASTA scores: opt: 1801, E(): 3.9e-103, (80.3% identity in 345 aa overlap); etc. Contains PS01103 Aspartate-semialdehyde dehydrogenase signature. Belongs to the aspartate-semialdehyde dehydrogenase family.
Molecular mass (Da)36230.2
Isoelectric point4.644
Gene length (bp)1038
Protein length345
Location (kb)4151.18


Functional categoryintermediary metabolism and respiration


ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011).
Mutationessential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS41511804152217-
RBS41522244152227-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv3708c|asd
MGLSIGIVGATGQVGQVMRTLLDERDFPASAVRFFASARSQGRKLAFRGQEIEVEDAETA
DPSGLDIALFSAGSAMSKVQAPRFAAAGVTVIDNSSAWRKDPDVPLVVSEVNFERDAHRR
PKGIIANPNCTTMAAMPVLKVLHDEARLVRLVVSSYQAVSGSGLAGVAELAEQARAVIGG
AEQLVYDGGALEFPPPNTYVAPIAFNVVPLAGSLVDDGSGETDEDQKLRFESRKILGIPD
LLVSGTCVRVPVFTGHSLSINAEFAQPLSPERARELLDGATGVQLVDVPTPLAAAGVDES
LVGRIRRDPGVPDGRGLALFVSGDNLRKGAALNTIQIAELLTADL
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
PFAMP0A542
Protein Data Bank2GUL 3LLG


Orthologs/Cross-references
CDC1551MT3811
Enzyme Classification1.2.1.11
Gene Ontologyaspartate-semialdehyde dehydrogenase activity
cytoplasm
methionine biosynthetic process
threonine biosynthetic process
diaminopimelate biosynthetic process
protein dimerization activity
NADP or NADPH binding
NAD or NADH binding
oxidation reduction
M. bovisMb3735c
M. lepraeML2322
M. marinumMMAR_5221
M. smegmatisMSMEG_6256
UniProtP0A542
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv3708c


Expression Data
TBDBRv3708c


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Gu S, Chen J, Dobos KM, Bradbury EM, Belisle JT, Chen X,
Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain.
Mol Cell Proteomics (2003) 2(12):1284-96
Cited for: Proteomics
Malen H, Pathak S, Softeland T, de Souza GA, Wiker HG,
Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv.
BMC Microbiol (2010) 10:132
Cited for: Proteomics
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Kelkar DS, Kumar D, Kumar P, Balakrishnan L, Muthusamy B, Yadav AK, Shrivastava P, Marimuthu A, Anand S, Sundaram H, Kingsbury R, Harsha HC, Nair B, Prasad TS, Chauhan DS, Katoch K, Katoch VM, Kumar P, Chaerkady R, Ramachandran S, Dash D, Pandey A,
Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
Mol Cell Proteomics (2011) 10(12):M111.011627
Cited for: Proteomics/Sequence
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant
Cirillo JD, Weisbrod TR, Pascopella L, Bloom BR, Jacobs WR,
Isolation and characterization of the aspartokinase and aspartate semialdehyde dehydrogenase operon from mycobacteria
Mol Microbiol (1994) 11(4):629-39
Cited for: Sequence