Quick Search

Enter gene name or accession number


Search term: Rv3685c

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene namecyp137
Rv numberRv3685c
TypeCDS
FunctionCytochromes P450 are a group of heme-thiolate monooxygenases. They oxidize a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics.
ProductProbable cytochrome P450 137 Cyp137
CommentsRv3685c, (MTV025.033c), len: 476 aa. Probable cyp137, cytochrome P-450, similar to many e.g. Q9VXY0|C4S3_DROME|CYP4S3|CG9081 from Drosophila melanogaster (Fruit fly) (495 aa), FASTA scores: opt: 376, E(): 1.2e-15, (28.35% identity in 413 aa overlap); Q59163|CYP110A2 from Anabaena variabilis (459 aa) FASTA scores: opt: 320, E(): 3.1e-12, (31.4% identity in 411 aa overlap); O23051|C883_ARATH from Arabidopsis thaliana (Mouse-ear cress) (490 aa), FASTA scores: opt: 313, E(): 8.8e-12, (28.25% identity in 425 aa overlap); etc. Also similar to many from Mycobacterium tuberculosis e.g. O53765|C13B_MYCTU|CYP135B1|Rv0568|MT0594|MTV039.06 (472 aa), FASTA scores: opt: 920, E(): 4.6e-49, (36.25% identity in 447 aa overlap); P96813|C138_MYCTU|CYP138|Rv0136|MT0144|MTCI5.10 (441 aa) FASTA scores: opt: 886, E(): 5.3e-47, (35.5% identity in 445 aa overlap); etc. Belongs to the cytochrome P450 family.
Molecular mass (Da)52265.6
Isoelectric point10.4204
Gene length (bp)1431
Protein length476
Location (kb)4127.29


Functional categoryintermediary metabolism and respiration


ProteomicsIdentified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS41272954128725-
RBS41287304128733-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv3685c|cyp137
MVLRSLASPAALTDPKRCASVVGVAAFAVRREHAPDALGGPPGLPAPRGFRAAFAAAYAV
AYLAGGERRMLRLIRRYGPIMTMPILSLGDVAIVSDSALAKEVFTAPTDVLLGGEGVGPA
AAIYGSGSMFVQEEPEHLRRRKLLTPPLHGAALDRYVPIIENSTRAAMHTWPVDRPFAML
TVARSLMLDVIVKVIFGVDDPEEVRRLGRPFERLLNLGVSEQLTVRYALRRLGALRVWPA
RARANTEIDDVVMALIAQRRADPRLGERHDVLSLLVSARGESGEQLSDSEIRDDLITLVL
AGHETTATTLAWAFDLLLHHPDALRRVRAEAVGGGEAFTTAVINETLRVRPPAPLTARVA
AQPLTIGGYRVEAGTRIVVHIIAINRSAEVYEHPHEFRPERFLGTRPQTYAWVPFGGGVK
RCLGANFSMRELITVLHVLLREGEFTAVDDEPERIVRRSIMLVPRRGTRVRFRPAR
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMO69653


Orthologs/Cross-references
CDC1551MT3787
Enzyme Classification1.14.-.-
Gene Ontologymonooxygenase activity
electron carrier activity
heme binding
oxidation reduction
M. bovisMb3710c
M. marinumMMAR_5175
UniProtO69653
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv3685c


Expression Data
TBDBRv3685c


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Mawuenyega KG, Forst CV, Dobos KM, Belisle JT, Chen J, Bradbury EM, Bradbury AR, Chen X,
Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling.
Mol Biol Cell (2005) 16(1):396-404
Cited for: Proteomics
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant