Quick Search

Enter gene name or accession number


Search term: Rv3432c

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene namegadB
Rv numberRv3432c
TypeCDS
FunctionCatalyzes the production of GABA [catalytic activity: L-glutamate = 4-aminobutanoate + CO(2)].
ProductProbable glutamate decarboxylase GadB
CommentsRv3432c, (MTCY77.04c), len: 460 aa. Probable gadB, glutamate decarboxylase, similar to many e.g. P73043|gad|SLL1641 from Synechocystis sp. strain PCC 6803 (467 aa), FASTA scores: opt: 1684, E(): 6.2e-99, (55.35% identity in 457 aa overlap); Q9X8J5|SCE9.23 from Streptomyces coelicolor (475 aa), FASTA scores: opt: 1650, E(): 8.9e-97, (57.4% identity in 446 aa overlap); Q9AQU4|gad from Oryza sativa (Rice) (501 aa), FASTA scores: opt: 1498, E(): 3.7e-87, (51.6% identity in 432 aa overlap); Q07346|DCE_PETHY from Petunia hybrida (Petunia) (500 aa), FASTA scores: opt: 1485, E(): 2.5e-86, (51.15% identity in 437 aa overlap); etc. Belongs to group II decarboxylases (DDC, gad, HDC and TYRDC).
Molecular mass (Da)50747.7
Isoelectric point5.4052
Gene length (bp)1383
Protein length460
Location (kb)3850.37


Functional categoryintermediary metabolism and respiration


ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website
RegulonPredicted to be in the RelA|Rv2583c regulon (See Dahl et al., 2003).


Coordinates
TypeStartEndOrientation
CDS38503723851754-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv3432c|gadB
VSRSHPSVPAHSIAPAYTGRMFTAPVPALRMPDESMDPEAAYRFIHDELMLDGSSRLNLA
TFVTTWMDPEAEKLMAETFDKNMIDKDEYPATAAIEARCVSMVADLFHAEGLRDHDPTSA
TGVSTIGSSEAVMLGGLALKWRWRQRVGSWKGRMPNLVMGSNVQVVWEKFCRYFDVEPRY
LPMERGRYVITPEQVLAAVDENTIGVVAILGTTYTGELEPIAEICAALDKLAAGGGVDVP
VHVDAASGGFVVPFLHPDLVWDFRLPRVVSINVSGHKYGLTYPGVGFVVWRGPEHLPEDL
VFRVNYLGGDMPTFTLNFSRPGNQVVGQYYNFLRLGRDGYTKVMQALSHTARWLGDQLRE
VDHCEVISDGSAIPVVSFRLAGDRGYTEFDVSHELRTFGWQVPAYTMPDNATDVAVLRIV
VREGLSADLARALHDDAVTALAALDKVKPGGHFDAQHFAH
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMO06249


Orthologs/Cross-references
CDC1551MT3538
Enzyme Classification4.1.1.15
Gene Ontologyglutamate decarboxylase activity
glutamate metabolic process
pyridoxal phosphate binding
M. bovisMb3462c
M. lepraeML0374
M. marinumMMAR_1118
M. smegmatisMSMEG_1574
UniProtO06249
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv3432c


Expression Data
TBDBRv3432c


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Dahl JL, Kraus CN, Boshoff HI, Doan B, Foley K, Avarbock D, Kaplan G, Mizrahi V, Rubin H, Barry CE 3rd,
The role of RelMtb-mediated adaptation to stationary phase in long-term persistence of Mycobacterium tuberculosis in mice.
Proc Natl Acad Sci U S A (2003) 100(17):10026-31
Cited for: Regulon
Malen H, Pathak S, Softeland T, de Souza GA, Wiker HG,
Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv.
BMC Microbiol (2010) 10:132
Cited for: Proteomics
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant