Quick Search

Enter gene name or accession number


Search term: Rv3222c

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv3222c
Rv numberRv3222c
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv3222c, (MTCY07D11.04), len: 183 aa. Hypothetical protein, with some similarity to Q9SZD2|F19B15.50|AT4G29020 glycine-rich protein like from Arabidopsis thaliana (Mouse-ear cress) (158 aa), FASTA scores: opt: 131, E(): 0.77, (33.35% identity in 126 aa overlap); Q9S222|SCI51.18 putative transcriptional regulator from Streptomyces coelicolor (548 aa), FASTA scores: opt: 133, E(): 1.6, (36.25% identity in 149 aa overlap); etc. Also some similarity to other hypothetical Mycobacterium tuberculosis proteins e.g. O06292|Rv0341|MTCY13E10.01 (479 aa), FASTA scores: opt: 141, E(): 0.5, (31.2% identity in 170 aa overlap); AAK45760|MT1497.1 PE_PGRS family protein from strain CDC1551 (1408 aa), FASTA scores: opt: 137, E(): 2, (31.75% identity in 148 aa overlap); etc.
Molecular mass (Da)18315.5
Isoelectric point6.5118
Gene length (bp)552
Protein length183
Location (kb)3598.35


Functional categoryconserved hypotheticals
Prediction based on GO and InterPro: information pathways (See Mazandu and Mulder, 2012)


ProteomicsIdentified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 90 days but not 30 days (See Kruh et al., 2010).
MutationEssential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS35983533598904-
RBS35989153598918-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv3222c|Rv3222c
MSSPVSSRRLANLVKESLQGSVLGGVVSDAVLPAVSDDVKPGAGEDAYRVPVVVAAGSGA
VVQVGGLEVGSAAVAGEVADTVAELFVCRPTEPDVGDFVGLAGGAGDAGQAGQQFGLGVG
VRGESFGARRRLALSTVGASGATAGLRKTHDGHHGCQARGALTQRRLYIGNPSEITDTRM
VHQ
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
CDC1551MT3319
M. bovisMb3249c
UniProtO05844
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv3222c


Expression Data
TBDBRv3222c


Bibliography
Kruh NA, Troudt J, Izzo A, Prenni J, Dobos KM,
Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo.
PLoS One (2010) 5(11):e13938
Cited for: Proteomics
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant
Mazandu GK, Mulder NJ,
Function Prediction and Analysis of Mycobacterium tuberculosis Hypothetical Proteins.
Int J Mol Sci (2012) 13(6):7283-302
Cited for: Function