Quick Search

Enter gene name or accession number


Search term: Rv3221c

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameTB7.3
Rv numberRv3221c
TypeCDS
FunctionFunction unknown
ProductBiotinylated protein TB7.3
CommentsRv3221c, (MTCY07D11.05), len: 71 aa. TB7.3, Biotinylated protein (see citations below), equivalent (appears to have one additional residue) to Q9CCH9|ML0802|BTB7_MYCLE biotinylated protein TB7.3 homolog from Mycobacterium leprae (70 aa), FASTA scores: opt: 367, E(): 4e-18, (90.0% identity in 70 aa overlap); Q9XCD6|BTB7_MYCSM biotinylated protein TB7.3 homolog from Mycobacterium smegmatis (70 aa), FASTA scores: opt: 341, E(): 2.1e-16, (84.05% identity in 69 aa overlap). Similar to C-terminal part of various proteins e.g. Q9HPP8|ACC|VNG1532G biotin carboxylase from Halobacterium sp. strain NRC-1 (610 aa), FASTA scores: opt: 212, E(): 4e-07, (50.0% identity in 68 aa overlap); Q58628|PYCB_METJA|MJ1231 pyruvate carboxylase subunit B from Methanococcus jannaschii (567 aa), FASTA scores: opt: 192, E(): 7.8e-06, (44.8% identity in 58 aa overlap); Q9ZAA7|GCDC glutaconyl-CoA decarboxylase gamma subunit from Acidaminococcus fermentans (145 aa), FASTA scores: opt: 184, E(): 8.9e-06, (39.4% identity in 66 aa overlap); etc.
Molecular mass (Da)7306.46
Isoelectric point3.7179
Gene length (bp)216
Protein length71
Location (kb)3597.55


Functional categorylipid metabolism


ProteomicsThe product of this CDS corresponds to spot TB7.3 identified in short term culture filtrate by proteomics at the Statens Serum Institute (Denmark) (see citations below).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS35975513597766-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv3221c|TB7.3
MAEDVRAEIVASVLEVVVNEGDQIDKGDVVVLLESMKMEIPVLAEAAGTVSKVAVSVGDV
IQAGDLIAVIS
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMP0A510


Orthologs/Cross-references
CDC1551MT3317
M. bovisMb3247c
M. lepraeML0802
M. marinumMMAR_1336
M. smegmatisMSMEG_1917
UniProtP0A510
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv3221c


Expression Data
TBDBRv3221c


Bibliography
Skjot RL, Oettinger T, Rosenkrands I, Ravn P, Brock I, Jacobsen S, Andersen P,
Comparative evaluation of low-molecular-mass proteins from Mycobacterium tuberculosis identifies members of the ESAT -6 family as immunodominant T-cell antigens
Infect Immun (2000) 68(1):214-20
Cited for: Proteomics
Rosenkrands I, Weldingh K, Jacobsen S, Hansen CV, Florio W, Gianetri I, Andersen P,
Mapping and identification of Mycobacterium tuberculosis proteins by two-dimensional gel electrophoresis, microsequencing and immunodetection
Electrophoresis (2000) 21(5):935-48
Cited for: Proteomics
Rosenkrands I, King A, Weldingh K, Moniatte M, Moertz E, Andersen P,
Towards the proteome of Mycobacterium tuberculosis
Electrophoresis (2000) 21(17):3740-56
Cited for: Proteomics
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant