Quick Search

Enter gene name or accession number


Search term: Rv3221A

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene namershA
Rv numberRv3221A
TypeCDS
FunctionBinds sigma factor sigh and inhibits it. Probably involved in survival following heat shock and oxidative stress.
ProductAnti-sigma factor RshA
CommentsRv3221A, len: 101 aa. RshA, anti-sigma factor, similar to Q9XCD7|AAD41811.1 unknown protein from Mycobacterium smegmatis, linked to sigma factor sigH (see Fernandes et al., 1999) (101 aa), FASTA scores: opt: 422, E(): 3.4e-22, (64.9% identity in 94 aa overlap); and to Q9RL96|RsrA anti-sigma factor from Streptomyces coelicolor (see Kang et al., 1999) (105 aa), FASTA scores: opt: 163, E(): 0.00016, (32.05% identity in 78 aa overlap).
Molecular mass (Da)11257.7
Isoelectric point6.6572
Gene length (bp)306
Protein length101
Location (kb)3598.05


Functional categoryinformation pathways


Mutation Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS35980513598356-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv3221A|rshA
VSENCGPTDAHADHDDSHGGMGCAEVIAEVWTLLDGECTPETRERLRRHLEACPGCLRHY
GLEERIKALIGTKCRGDRAPEGLRERLRLEIRRTTIIRGGP
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
CDC1551MT3318
M. bovisMb3248c
M. lepraeML0802A
M. marinumMMAR_1335
M. smegmatisMSMEG_1915
UniProtQ8VJ46
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv3221A


Expression Data
TBDBRv3221A


Bibliography
Fernandes ND, Wu QL, Kong D, Puyang X, Garg S, Husson RN,
A mycobacterial extracytoplasmic sigma factor involved in survival following heat shock and oxidative stress
J Bacteriol (1999) 181(14):4266-74
Cited for: Homolog/Mutant
Kang JG, Paget MS, Seok YJ, Hahn MY, Bae JB, Hahn JS, Kleanthous C, Buttner MJ, Roe JH,
RsrA, an anti -sigma factor regulated by redox change
EMBO J (1999) 18(15):4292-8
Cited for: Homolog/Sequence/Function
Song T, Dove SL, Lee KH, Husson RN,
RshA, an anti-sigma factor that regulates the activity of the mycobacterial stress response sigma factor SigH.
Mol Microbiol (2003) 50(3):949-59
Cited for: Biochemistry/Function
Jeong EH, Son YM, Hah YS, Choi YJ, Lee KH, Song T, Kim DR,
RshA mimetic peptides inhibiting the transcription driven by a Mycobacterium tuberculosis sigma factor SigH.
Biochem Biophys Res Commun (2006) 339(1):392-8
Cited for: Biochemistry
Park ST, Kang CM, Husson RN,
Regulation of the SigH stress response regulon by an essential protein kinase in Mycobacterium tuberculosis.
Proc Natl Acad Sci U S A (2008) 105(35):13105-10
Cited for: Biochemistry