Quick Search

Enter gene name or accession number


Search term: Rv3220c

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv3220c
Rv numberRv3220c
TypeCDS
FunctionSensor part of a two component regulatory system.
ProductProbable two component sensor kinase
CommentsRv3220c, (MTCY07D11.06), len: 501 aa. Probable sensor (probably histidine kinase), equivalent to Q9CCH8|ML0803 putative two-component system sensor kinase from Mycobacterium leprae (500 aa). Similar to others e.g. Q9F3M1|2SC7G11.01 putative histidine kinase (fragment) from Streptomyces coelicolor (372 aa), FASTA scores: opt: 1038, E(): 7.4e-56, (48.95% identity in 380 aa overlap); Q9A3K5|CC3198 sensor histidine kinase from Caulobacter crescentus (327 aa), FASTA scores: opt: 311, E(): 1.2e-11, (33.35% identity in 201 aa overlap) (similarity only in C-terminal part for this one); Q9A2T2|CC3474 putative sensor histidine kinase from Caulobacter crescentus (547 aa); etc. C-terminal half shows similarity to many sensor proteins, that respond to various stimuli from Methanobacterium thermoautotrophicum e.g. O26568|MTH468 sensory transduction histidine kinase (554 aa), FASTA scores: opt: 425, E(): 2.1e-18, (34.0% identity in 244 aa overlap); O26546|MTH446 sensory transduction regulatory protein (583 aa), FASTA scores: opt: 380, E(): 1.2e-15, (37.15% identity in 202 aa overlap); O26913|MTH823 sensory transduction regulatory protein (677 aa), FASTA scores: opt: 375, E(): 2.7e-15, (35.4% identity in 195 aa overlap); etc. Seems similar to other prokaryotic sensory transduction histidine kinases.
Molecular mass (Da)54012.5
Isoelectric point5.5788
Gene length (bp)1506
Protein length501
Location (kb)3596.03


Functional categoryregulatory proteins


ProteomicsIdentified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
Mutationnon essential gene by Himar1-based transposon mutagenesis in CDC1551 strain (see Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Virulence of M. tuberculosis H37Rv mutant in SCID mice is unchanged (See Parish et al., 2004).
see TB knockouts/mutants availability


Coordinates
TypeStartEndOrientation
CDS35960293597534-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv3220c|Rv3220c
MSTLGDLLAEHTVLPGSAVDHLHAVVGEWQLLADLSFADYLMWVRRDDGVLVCVAQCRPN
TGPTVVHTDAVGTVVAANSMPLVAATFSGGVPGREGAVGQQNSCQHDGHSVEVSPVRFGD
QVVAVLTRHQPELAARRRSGHLETAYRLCATDLLRMLAEGTFPDAGDVAMSRSSPRAGDG
FIRLDVDGVVSYASPNALSAYHRMGLTTELEGVNLIDATRPLISDPFEAHEVDEHVQDLL
AGDGKGMRMEVDAGGATVLLRTLPLVVAGRNVGAAILIRDVTEVKRRDRALISKDATIRE
IHHRVKNNLQTVAALLRLQARRTSNAEGREALIESVRRVSSIALVHDALSMSVDEQVNLD
EVIDRILPIMNDVASVDRPIRINRVGDLGVLDSDRATALIMVITELVQNAIEHAFDPAAA
EGSVTIRAERSARWLDVVVHDDGLGLPQGFSLEKSDSLGLQIVRTLVSAELDGSLGMRDA
RERGTDVVLRVPVGRRGRLML
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMO05846


Orthologs/Cross-references
CDC1551MT3316
Enzyme Classification2.7.13.3
Gene Ontologytwo-component sensor activity
two-component signal transduction system (phosphorelay)
ATP binding
signal transduction
peptidyl-histidine phosphorylation
M. bovisMb3246c
M. lepraeML0803
M. marinumMMAR_1337
M. smegmatisMSMEG_1918
UniProtO05846
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv3220c


Expression Data
TBDBRv3220c


Bibliography
Parish T, Smith DA, Kendall S, Casali N, Bancroft GJ, Stoker NG,
Deletion of two-component regulatory systems increases the virulence of Mycobacterium tuberculosis.
Infect Immun (2003) 71(3):1134-40
Cited for: Mutant/Secondary/Function
Lamichhane G, Zignol M, Blades NJ, Geiman DE, Dougherty A, Grosset J, Broman KW, Bishai WR,
A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis.
Proc Natl Acad Sci U S A (2003) 100(12):7213-8
Cited for: Mutant
Kruh NA, Troudt J, Izzo A, Prenni J, Dobos KM,
Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo.
PLoS One (2010) 5(11):e13938
Cited for: Proteomics
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant