Quick Search

Enter gene name or accession number


Search term: Rv3219

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene namewhiB1
Rv numberRv3219
Synonym(s)whmE
TypeCDS
FunctionInvolved in transcriptional mechanism.
ProductTranscriptional regulatory protein WhiB-like WhiB1. Contains [4FE-4S]2+ cluster.
CommentsRv3219, (MTCY07D11.07c), len: 84 aa. WhiB1 (alternate gene name: whmE), WhiB-like regulatory protein (see Hutter and Dick, 1999), similar to WhiB paralogue of Streptomyces coelicolor. Equivalent to Q9CCH7|WHIB1|ML0804 putative transcriptional regulator from Mycobacterium leprae (84 aa), FASTA scores: opt: 580, E(): 3.5e-35, (95.25% identity in 84 aa overlap). Highly similar to several e.g. Q9X952|WBLE developmental regulatory protein WhiB-paralog from Streptomyces coelicolor (85 aa), FASTA scores: opt: 477, E(): 9.2e-28, (75.3% identity in 81 aa overlap); Q9AD55|SCP1.95 putative regulatory protein from Streptomyces coelicolor (102 aa), FASTA scores: opt: 383, E(): 6.1e-21, (60.75% identity in 79 aa overlap); Q9K4K8|SC5F8.16c from Streptomyces coelicolor (83 aa), FASTA scores: opt: 346, E(): 2.5e-18, (54.75% identity in 84 aa overlap); etc.
Molecular mass (Da)9318.55
Isoelectric point8.3434
Gene length (bp)255
Protein length84
Location (kb)3595.71


Functional categoryregulatory proteins


TranscriptomeDNA microarrays show higher level of expression in M. tuberculosis H37Rv than in Rv3676 mutant (See Rickman et al., 2005). DNA microarrays show lower level of expression in M. tuberculosis H37Rv than in phoP|Rv0757 mutant (See Walters et al., 2006).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Attempts to delete whiB1|Rv3219 from M. tuberculosis H37Rv were unsuccessful, unless whiB1 was present on a plasmid (See Smith et al., 2010). Check for mutants available at TARGET website
RegulonIn the Crp|Rv3676 regulon (See Rickman et al., 2005; Agarwal et al., 2006). Promoter has 2 Crp|Rv3676 binding sites; binding to the upstream site enhances expression while binding to the downstream site or both sites represses expression (See Stapleton et al., 2010). EMSA shows reduced and oxidized apo-WhiB1 bind to its own promoter, the [4Fe-4S] form of WhiB1 does not bind unless treated with NO; DNase I footprinting also shows binding; WhiB1 inhibits whiB1 transription in vitro (See Smith et al., 2010).


Coordinates
TypeStartEndOrientation
RBS35956993595703+
CDS35957133595967+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv3219|whiB1
MDWRHKAVCRDEDPELFFPVGNSGPALAQIADAKLVCNRCPVTTECLSWALNTGQDSGVW
GGMSEDERRALKRRNARTKARTGV
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMO05847


Orthologs/Cross-references
CDC1551MT3315
M. bovisMb3245
M. lepraeML0804
M. marinumMMAR_1338
M. smegmatisMSMEG_1919
UniProtO05847
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv3219


Expression Data
TBDBRv3219


Bibliography
Hutter B, Dick T,
Molecular genetic characterisation of whiB3, a mycobacterial homologue of a Streptomyces sporulation factor
Res Microbiol (1999) 150(5):295-301
Cited for: Homolog/Mutant
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Rickman L, Scott C, Hunt DM, Hutchinson T, Menendez MC, Whalan R, Hinds J, Colston MJ, Green J, Buxton RS,
A member of the cAMP receptor protein family of transcription regulators in Mycobacterium tuberculosis is required for virulence in mice and controls transcription of the rpfA gene coding for a resuscitation promoting factor.
Mol Microbiol (2005) 56(5):1274-86
Cited for: Transcriptome
Walters SB, Dubnau E, Kolesnikova I, Laval F, Daffe M, Smith I,
The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis.
Mol Microbiol (2006) 60(2):312-30
Cited for: Transcriptome
Agarwal N, Raghunand TR, Bishai WR,
Regulation of the expression of whiB1 in Mycobacterium tuberculosis: role of cAMP receptor protein.
Microbiology (2006) 152(Pt 9):2749-56
Cited for: Regulon
Stapleton M, Haq I, Hunt DM, Arnvig KB, Artymiuk PJ, Buxton RS, Green J,
Mycobacterium tuberculosis cAMP receptor protein (Rv3676) differs from the Escherichia coli paradigm in its cAMP binding and DNA binding properties and transcription activation properties.
J Biol Chem (2010) 285(10):7016-27
Cited for: Regulon
Smith LJ, Stapleton MR, Fullstone GJ, Crack JC, Thomson AJ, Le Brun NE, Hunt DM, Harvey E, Adinolfi S, Buxton RS, Green J,
Mycobacterium tuberculosis WhiB1 is an essential DNA-binding protein with a nitric oxide-sensitive iron-sulfur cluster.
Biochem J (2010) 432(3):417-27
Cited for: Mutant/Regulon