Quick Search

Enter gene name or accession number


Search term: Rv3218

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv3218
Rv numberRv3218
TypeCDS
FunctionFunction unknown
ProductConserved protein
CommentsRv3218, (MTCY07D11.08c), len: 321 aa. Conserved protein, similar to several hypothetical bacterial proteins e.g. Q9F3M0|2SC7G11.03c from Streptomyces coelicolor (322 aa), FASTA scores: opt: 694, E(): 4.2e-35, (39.95% identity in 328 aa overlap); Q9A0J4|SPY0752 from Streptomyces pyogenes (340 aa), FASTA scores: opt: 187, E(): 0.00033, (30.5% identity in 141 aa overlap); O31502|YERQ from Bacillus subtilis (303 aa), FASTA scores: opt: 184, E(): 0.00045, (34.15% identity in 126 aa overlap); etc.
Molecular mass (Da)34474.5
Isoelectric point9.2926
Gene length (bp)966
Protein length321
Location (kb)3594.47


Functional categoryconserved hypotheticals
Prediction based on GO and InterPro: intermediary metabolism and respiration (See Mazandu and Mulder, 2012)


ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS (See Xiong et al., 2005). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS35944683595433+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv3218|Rv3218
MRAVLIVNPTATATTPAGRDLLAHALESRLQLTVEHTNHRGHGTELGQAAVADGVDLVVV
HGGDGTVSAVVNGMLGRPGTTPVRPVPAVAVVPGGSANVLARALGISADPIAATNQLIQL
LDDYGRHQQWRRIGLIDCGERWAVFNAGMGVDAEVVAAVEAERDKGGKVTAWRYIRAAVR
AVLACTRREPALTLQLPNRDPITGVHFVFVSNSSPWTYANNRPVWTNPDCRFESGLGVFA
TTSMKVVPTLRVVRQMFAKQPKFEFNHVINNDDVACLRVTSMGPPIASQFDGDYLGVRET
MTFRAVPDALAVVAPPARKRI
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMO05848


Orthologs/Cross-references
CDC1551MT3314
Gene Ontologydiacylglycerol kinase activity
activation of protein kinase C activity by G-protein coupled receptor protein signaling pathway
M. bovisMb3244
M. lepraeML0805
M. marinumMMAR_1339
M. smegmatisMSMEG_1920
UniProtO05848
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv3218


Expression Data
TBDBRv3218


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Lamichhane G, Zignol M, Blades NJ, Geiman DE, Dougherty A, Grosset J, Broman KW, Bishai WR,
A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis.
Proc Natl Acad Sci U S A (2003) 100(12):7213-8
Cited for: Mutant
Gu S, Chen J, Dobos KM, Bradbury EM, Belisle JT, Chen X,
Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain.
Mol Cell Proteomics (2003) 2(12):1284-96
Cited for: Proteomics
Xiong Y, Chalmers MJ, Gao FP, Cross TA, Marshall AG,
Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry.
J Proteome Res (2005) 4(3):855-61
Cited for: Proteomics
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant
Mazandu GK, Mulder NJ,
Function Prediction and Analysis of Mycobacterium tuberculosis Hypothetical Proteins.
Int J Mol Sci (2012) 13(6):7283-302
Cited for: Function