Quick Search

Enter gene name or accession number


Search term: Rv3217c

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv3217c
Rv numberRv3217c
TypeCDS
FunctionUnknown
ProductProbable conserved integral membrane protein
CommentsRv3217c, (MTCY07D11.09), len: 143 aa. Probable conserved integral membrane protein, equivalent (highly similar but shorter 30 aa) to Q9CCH6|ML0806 putative membrane protein from Mycobacterium leprae (173 aa). Also similar to others e.g. Q9F3L9|2SC7G11.04 putative integral membrane protein from Streptomyces coelicolor (152 aa), FASTA scores: opt: 177, E(): 0.00024, (33.8% identity in 136 aa overlap). And shows similarity to O34238|MVIN|VC0680 virulence factor MVIN homolog from Vibrio (525 aa), FASTA scores: opt: 126, E(): 0.97, (30.9% identity in 68 aa overlap). First GTG taken. A core mycobacterial gene; conserved in mycobacterial strains (See Marmiesse et al., 2004).
Molecular mass (Da)14259.9
Isoelectric point12.3302
Gene length (bp)432
Protein length143
Location (kb)3593.8


Functional categorycell wall and cell processes


TranscriptomeDNA microarrays show increased expression in M. tuberculosis H37Rv in BALB/c mice compared to SCID mice, after 21 days of infection (See Talaat et al., 2004).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS35938043594235-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv3217c|Rv3217c
VPVRAPAAVRGAGLIVAVQGGAALVVAAALLVRGLAGADQHIVNGLGTAGWFVLVGGAVL
AAGCRLAVGKLWGRGLAVFAQLLLLPVAWYLIVGSHQPAIGIPVGIIALGVLVLLFSPPS
IRWAAGRDQRGAASAANRGPDSR
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
M. bovisMb3243c
M. lepraeML0806
M. marinumMMAR_1340
M. smegmatisMSMEG_1923
UniProtO05849
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv3217c


Expression Data
TBDBRv3217c


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Marmiesse M, Brodin P, Buchrieser C, Gutierrez C, Simoes N, Vincent V, Glaser P, Cole ST, Brosch R,
Macro-array and bioinformatic analyses reveal mycobacterial 'core' genes, variation in the ESAT-6 gene family and new phylogenetic markers for the Mycobacterium tuberculosis complex.
Microbiology (2004) 150(Pt 2):483-96
Cited for: Homology
Talaat AM, Lyons R, Howard ST, Johnston SA,
The temporal expression profile of Mycobacterium tuberculosis infection in mice.
Proc Natl Acad Sci U S A (2004) 101(13):4602-7
Cited for: Transcriptome
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant