Quick Search

Enter gene name or accession number


Search term: Rv3145

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene namenuoA
Rv numberRv3145
TypeCDS
FunctionInvolved in aerobic|anaerobic respiration [catalytic activity: NADH + ubiquinone = NAD(+) + ubiquinol].
ProductProbable NADH dehydrogenase I (chain A) NuoA (NADH-ubiquinone oxidoreductase chain A)
CommentsRv3145, (MTCY03A2.13c), len: 128 aa. Probable nuoA, integral membrane NADH dehydrogenase, chain A, similar to others e.g. Q9XAQ4|NUOA from Streptomyces coelicolor (119 aa), FASTA scores: opt: 405, E(): 5.4e-20, (68.75% identity in 128 aa overlap); Q9RU86|DR1506 from Deinococcus radiodurans (160 aa), FASTA scores: opt: 327, E(): 9e-15, (40.3% identity in 124 aa overlap); BAB47039|NDHC from Triticum aestivum (Wheat), FASTA scores: opt: 273, E(): 2.6e-11, (38.1% identity in 126 aa overlap); etc. Also similar to a NADH-plastoquinone oxidoreductases e.g. P26303|NU3C_WHEAT|NDHC from Triticum aestivum (Wheat) (120 aa), FASTA scores: opt: 273, E(): 2.6e-1, (38.1% identity in 126 aa overlap). Belongs to the complex I subunit 3 family.
Molecular mass (Da)13957.4
Isoelectric point8.4038
Gene length (bp)387
Protein length128
Location (kb)3511.68


Functional categoryintermediary metabolism and respiration


ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
TranscriptomemRNA identified by microarray analysis: transcription repressed at low pH in vitro conditions, which may mimic an environmental signal encountered by phagocytosed bacteria (see Fisher et al., 2002) and down-regulated after 24h and 96h of starvation (see Betts et al., 2002).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
RBS35116743511677+
CDS35116823512068+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv3145|nuoA
LNVYIPILVLAALAAAFAVVSVVIASLVGPSRFNRSKQAAYECGIEPASTGARTSIGPGA
ASGQRFPIKYYLTAMLFIVFDIEIVFLYPWAVSYDSLGTFALVEMAIFMLTVFVAYAYVW
RRGGLTWD
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMP65563


Orthologs/Cross-references
CDC1551MT3233
Enzyme Classification1.6.99.5
Gene Ontologyplasma membrane
transport
NADH dehydrogenase (ubiquinone) activity
integral to membrane
photosynthesis, light reaction
quinone binding
oxidation reduction
M. bovisMb3169
M. marinumMMAR_1483
M. smegmatisMSMEG_2063
UniProtP65563
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv3145


Expression Data
TBDBRv3145


Bibliography
Betts JC, Lukey PT, Robb LC, McAdam RA, Duncan K,
Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling
Mol Microbiol (2002) 43(3):717-31
Cited for: Transcriptome
Fisher MA, Plikaytis BB, Shinnick TM,
Microarray analysis of the Mycobacterium tuberculosis transcriptional response to the acidic conditions found in phagosomes
J Bacteriol (2002) 184(14):4025-32
Cited for: Transcriptome/Regulation
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Malen H, Pathak S, Softeland T, de Souza GA, Wiker HG,
Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv.
BMC Microbiol (2010) 10:132
Cited for: Proteomics
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant