Quick Search

Enter gene name or accession number


Search term: Rv3136

** Showing annotation for Rv3136. Did you mean: Rv3136A


General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from JTubercuList
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene namePPE51
Rv numberRv3136
TypeCDS
FunctionFunction unknown
ProductPPE family protein PPE51
CommentsRv3136, (MTCY03A2.22c), len: 380 aa. PPE51, Member of the Mycobacterium tuberculosis Ala-, Gly-rich PPE family, similar to Q9AGF0|Ov2770c Rv2770c-like protein from M. microti (397 aa), FASTA scores: opt: 917, E(): 9e-41, (46.15% identity in 388 aa overlap); O33312|Rv2770c|MTV002.35c, MTV002_36, MTCI125_26, MTCY10G2_10, MTCI364_8, MTV049_28, MTV049_29, etc.
Molecular mass (Da)37979.9
Isoelectric point4.1064
Gene length (bp)1143
Protein length380
Location (kb)3501.79


Functional categoryPE/PPE
Prediction based on GO and InterPro: cell wall and cell processes (See Mazandu and Mulder, 2012)


ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011).
TranscriptomemRNA identified by microarray analysis and down-regulated after 4h and 96h of starvation (see citation below). DNA microarrays show higher level of expression in M. tuberculosis H37Rv than in Rv3676 mutant (See Rickman et al., 2005).
Mutation Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
RBS35017783501783+
CDS35017943502936+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv3136|PPE51
MDFALLPPEVNSARMYTGPGAGSLLAAAGGWDSLAAELATTAEAYGSVLSGLAALHWRGP
AAESMAVTAAPYIGWLYTTAEKTQQTAIQARAAALAFEQAYAMTLPPPVVAANRIQLLAL
IATNFFGQNTAAIAATEAQYAEMWAQDAAAMYGYATASAAAALLTPFSPPRQTTNPAGLT
AQAAAVSQATDPLSLLIETVTQALQALTIPSFIPEDFTFLDAIFAGYATVGVTQDVESFV
AGTIGAESNLGLLNVGDENPAEVTPGDFGIGELVSATSPGGGVSASGAGGAASVGNTVLA
SVGRANSIGQLSVPPSWAAPSTRPVSALSPAGLTTLPGTDVAEHGMPGVPGVPVAAGRAS
GVLPRYGVRLTVMAHPPAAG
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMQ7D623


Orthologs/Cross-references
CDC1551MT3221
M. bovisMb3160
M. marinumMMAR_0191
MMAR_1513
UniProtQ7D623
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv3136


Expression Data
TBDBRv3136


Bibliography
Betts JC, Lukey PT, Robb LC, McAdam RA, Duncan K,
Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling
Mol Microbiol (2002) 43(3):717-31
Cited for: Transcriptome
Rickman L, Scott C, Hunt DM, Hutchinson T, Menendez MC, Whalan R, Hinds J, Colston MJ, Green J, Buxton RS,
A member of the cAMP receptor protein family of transcription regulators in Mycobacterium tuberculosis is required for virulence in mice and controls transcription of the rpfA gene coding for a resuscitation promoting factor.
Mol Microbiol (2005) 56(5):1274-86
Cited for: Transcriptome
Malen H, Pathak S, Softeland T, de Souza GA, Wiker HG,
Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv.
BMC Microbiol (2010) 10:132
Cited for: Proteomics
de Souza GA, Arntzen MO, Fortuin S, Schurch AC, Malen H, McEvoy CR, van Soolingen D, Thiede B, Warren RM, Wiker HG,
Proteogenomic analysis of polymorphisms and gene annotation divergences in prokaryotes using a clustered mass spectrometry-friendly database.
Mol Cell Proteomics (2011) 10(1):M110.002527
Cited for: Proteomics/Sequence
Kruh NA, Troudt J, Izzo A, Prenni J, Dobos KM,
Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo.
PLoS One (2010) 5(11):e13938
Cited for: Proteomics
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Kelkar DS, Kumar D, Kumar P, Balakrishnan L, Muthusamy B, Yadav AK, Shrivastava P, Marimuthu A, Anand S, Sundaram H, Kingsbury R, Harsha HC, Nair B, Prasad TS, Chauhan DS, Katoch K, Katoch VM, Kumar P, Chaerkady R, Ramachandran S, Dash D, Pandey A,
Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
Mol Cell Proteomics (2011) 10(12):M111.011627
Cited for: Proteomics/Sequence
Mazandu GK, Mulder NJ,
Function Prediction and Analysis of Mycobacterium tuberculosis Hypothetical Proteins.
Int J Mol Sci (2012) 13(6):7283-302
Cited for: Function