Quick Search

Enter gene name or accession number


Search term: Rv3135

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from JTubercuList
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene namePPE50
Rv numberRv3135
TypeCDS
FunctionFunction unknown
ProductPPE family protein PPE50
CommentsRv3135, (MTCY03A2.23c), len: 132 aa. PPE50, Member of the Mycobacterium tuberculosis Ala-, Gly-rich PPE family, similar to P95190|Rv3136|MTCY03A2.22c (380 aa), FASTA scores: opt: 494, E(): 6.7e-25, (57.25% identity in 131 aa overlap) (next ORF downstream), MTY21C12_9, MTCY3C7_24, MTCI125_27, MTV049_12, MTV049_9, MTV049_11, MTCY274_24 etc.
Molecular mass (Da)13667.5
Isoelectric point4.9577
Gene length (bp)399
Protein length132
Location (kb)3501.33


Functional categoryPE/PPE


TranscriptomeDNA microarrays show higher level of expression in M. tuberculosis H37Rv than in phoP|Rv0757 mutant (See Walters et al., 2006).
Mutationessential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
RBS35013283501331+
CDS35013343501732+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv3135|PPE50
MDYAFLPPEINSARMYSGPGPNSMLVAAASWDALAAELASAAENYGSVIARLTGMHWWGP
ASTSMLAMSAPYVEWLERTAAQTKQTATQARAAAAAFEQAHAMTVPPALVTGIRGAIVVE
TASASNTAGTPP
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMQ6MX07


Orthologs/Cross-references
CDC1551MT3220.2
M. bovisMb3159
UniProtQ6MX07
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv3135


Expression Data
TBDBRv3135


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Walters SB, Dubnau E, Kolesnikova I, Laval F, Daffe M, Smith I,
The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis.
Mol Microbiol (2006) 60(2):312-30
Cited for: Transcriptome
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant