Quick Search

Enter gene name or accession number


Search term: Rv3134c

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from JTubercuList
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv3134c
Rv numberRv3134c
TypeCDS
FunctionFunction unknown. Could play a role in the adaptation to hypoxia, participating in the phosphorelay in the two component regulatory system DEVR|Rv3133c/DEVS|Rv3132c.
ProductUniversal stress protein family protein
CommentsRv3134c, (MTCY03A2.240, len: 268 aa. Universal stress protein family protein. Ala-, Val- rich (see citations below), related to other hypothetical Mycobacterium tuberculosis proteins e.g. O53474|Rv2028c|MTV018.15c (279 aa), FASTA scores: opt: 562, E(): 3.2e-28, (40.65% identity in 273 aa overlap); O06188|Rv2624c|MTCY01A10.08 (272 aa), FASTA scores: opt: 458, E(): 1.1e-21, (36.55% identity in 271 aa overlap); O53472|R2026c|MTV018.13c (294 aa), FASTA scores: opt: 232, E(): 1.9e-07, (30.45% identity in 276 aa overlap); etc. Shares some similarity with other hypothetical proteins from Streptomyces coelicolor e.g. Q9RIZ8|SCJ1.16c (294 aa), FASTA scores: opt: 207, E(): 6.9e-06, (28.9% identity in 263 aa overlap); Q9K4L5|SC5F8.09 putative stress-inducible protein (312 aa), FASTA scores: opt: 204, E(): 1.1e-05, (28.4% identity in 271 aa overlap); etc. Equivalent to AAK47558|MT3220 Universal stress protein family from Mycobacterium tuberculosis strain CDC1551 (268 aa). Rv3134c seems cotranscribed with devR-devS (see Sherman et al., 2001).
Molecular mass (Da)28007.9
Isoelectric point8.1759
Gene length (bp)807
Protein length268
Location (kb)3499.94


Functional categoryvirulence, detoxification, adaptation


ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005).
TranscriptomemRNA identified by DNA microarray analysis: gene induced by hypoxia (see Sherman et al., 2001), under microaerobic and anaerobic conditions (see Mayuri et al., 2002), and down-regulated after 4h of starvation (see Betts et al., 2002).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website
RegulonPredicted to be in the DosR|Rv3133c regulon, in M. tuberculosis 1254 (See Voskuil et al., 2003).


Coordinates
TypeStartEndOrientation
CDS34999433500749-
RBS35007563500761-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv3134c|Rv3134c
MSDPRPARAVVVGIDGSRAATHAALWAVDEAVNRDIPLRLVYVIDPSQLSAAGEGGGQSA
ARAALHDASRKVEATGQPVKIETEVLCGRPLTKLMQESRSAAMLCVGSVGLDHVRGRRGS
VAATLAGSALCPVAVIHPSPAEPATTSQVSAVVAEVDNGVVLRHAFEEARLRGVPLRAVA
VHAAETPDDVEQGSRLAHVHLSRRLAHWTRLYPEVRVDRAIAGGSACRHLAANAKPGQLF
VADSHSAHELCGAYQPGCAVLTVRSANL
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMP95192


Orthologs/Cross-references
CDC1551MT3220
Gene Ontologyresponse to stress
M. bovisMb3158c
M. marinumMMAR_1515
M. smegmatisMSMEG_5245
UniProtP95192
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv3134c


Expression Data
TBDBRv3134c


Bibliography
Sherman DR, Voskuil M, Schnappinger D, Liao R, Harrell MI, Schoolnik GK,
Regulation of the Mycobacterium tuberculosis hypoxic response gene encoding alpha -crystallin
Proc Natl Acad Sci U S A (2001) 98(13):7534-9
Cited for: Transcriptome
Betts JC, Lukey PT, Robb LC, McAdam RA, Duncan K,
Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling
Mol Microbiol (2002) 43(3):717-31
Cited for: Transcriptome
M ayuri, Bagchi G, Das TK, Tyagi JS,
Molecular analysis of the dormancy response in Mycobacterium smegmatis: expression analysis of genes encoding the DevR-DevS two -component system, Rv3134c and chaperone alpha-crystallin homologues
FEMS Microbiol Lett (2002) 211(2):231-7
Cited for: Product/Transcriptome
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Park HD, Guinn KM, Harrell MI, Liao R, Voskuil MI, Tompa M, Schoolnik GK, Sherman DR,
Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis.
Mol Microbiol (2003) 48(3):833-843
Cited for: Transcriptome
Lamichhane G, Zignol M, Blades NJ, Geiman DE, Dougherty A, Grosset J, Broman KW, Bishai WR,
A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis.
Proc Natl Acad Sci U S A (2003) 100(12):7213-8
Cited for: Mutant
Voskuil MI, Schnappinger D, Visconti KC, Harrell MI, Dolganov GM, Sherman DR, Schoolnik GK,
Inhibition of respiration by nitric oxide induces a Mycobacterium tuberculosis dormancy program.
J Exp Med (2003) 198(5):705-13
Cited for: Regulon
Gu S, Chen J, Dobos KM, Bradbury EM, Belisle JT, Chen X,
Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain.
Mol Cell Proteomics (2003) 2(12):1284-96
Cited for: Proteomics
Mawuenyega KG, Forst CV, Dobos KM, Belisle JT, Chen J, Bradbury EM, Bradbury AR, Chen X,
Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling.
Mol Biol Cell (2005) 16(1):396-404
Cited for: Proteomics
Hingley-Wilson SM, Lougheed KE, Ferguson K, Leiva S, Williams HD,
Individual Mycobacterium tuberculosis universal stress protein homologues are dispensable in vitro.
Tuberculosis (Edinb) (2010) 90(4):236-44
Cited for: Homology
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant