Quick Search

Enter gene name or accession number


Search term: Rv3132c

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene namedevS
Rv numberRv3132c
Synonym(s)dosS
TypeCDS
FunctionSensor part of the two component regulatory system DEVR/DEVS/dost. Thought to control HSPX|Rv2031|ACR expression; O2, NO and CO are ligands, DOSS is inactive in the presence of oxygen
ProductTwo component sensor histidine kinase DevS
CommentsRv3132c, (MTCY03A2.26), len: 578 aa. DevS (alternate gene name: dosS), membrane-bound two component sensor histidine kinase (see citations below; dev for Differentially Expressed in Virulent strain), similar to others two component sensors e.g. Q9RI43|SCJ12.15c putative two-component sensor from Streptomyces coelicolor (585 aa), FASTA scores: opt: 1305, E(): 2.5e-69, (41.35% identity in 573 aa overlap); Q9ZBY4|SCD78.15 putative two component sensor from Streptomyces coelicolor (560 aa), FASTA scores: opt: 1194, E(): 8.1e-63, (41.05% identity in 558 aa overlap); O85371|CPRS two component regulator from Rhodococcus sp (563 aa), FASTA scores: opt: 803, E(): 8.3e-40, (38.4% identity in 552 aa overlap); Q9L094|SCC24.23 putative two-component sensor histidine kinase from Streptomyces coelicolor (similarity only in C-terminus for this one); etc. Also highly similar to mycobacterium O53473|Rv2027c|MTV018.14c putative membrane protein (573 aa), FASTA scores: opt: 2333, E(): 7.6e-130, (61.45% identity in 576 aa overlap). Predicted possible vaccine candidate (See Zvi et al., 2008). Contains GAF domain that binds heme.
Molecular mass (Da)62240.6
Isoelectric point4.6819
Gene length (bp)1737
Protein length578
Location (kb)3497.53


Functional categoryregulatory proteins


ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Translational start site supported by proteomics data (See Kelkar et al., 2011).
TranscriptomemRNA identified by DNA microarray analysis: gene induced by hypoxia (see Sherman et al., 2001), under microaerobic and anaerobic conditions (see Mayuri et al., 2002), and down-regulated after 4h of starvation (see Betts et al., 2002).
Mutationessential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for survival in primary murine macrophages, by transposon site hybridization (TraSH) in H37Rv (See Rengarajan et al., 2005). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website
RegulonPredicted to be in the DosR|Rv3133c regulon, in M. tuberculosis 1254 (See Voskuil et al., 2003).


Coordinates
TypeStartEndOrientation
CDS34975293499265-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv3132c|devS
MTTGGLVDENDGAAMRPLRHTLSQLRLHELLVEVQDRVEQIVEGRDRLDGLVEAMLVVTA
GLDLEATLRAIVHSATSLVDARYGAMEVHDRQHRVLHFVYEGIDEETVRRIGHLPKGLGV
IGLLIEDPKPLRLDDVSAHPASIGFPPYHPPMRTFLGVPVRVRDESFGTLYLTDKTNGQP
FSDDDEVLVQALAAAAGIAVANARLYQQAKARQSWIEATRDIATELLSGTEPATVFRLVA
AEALKLTAADAALVAVPVDEDMPAADVGELLVIETVGSAVASIVGRTIPVAGAVLREVFV
NGIPRRVDRVDLEGLDELADAGPALLLPLRARGTVAGVVVVLSQGGPGAFTDEQLEMMAA
FADQAALAWQLATSQRRMRELDVLTDRDRIARDLHDHVIQRLFAIGLALQGAVPHERNPE
VQQRLSDVVDDLQDVIQEIRTTIYDLHGASQGITRLRQRIDAAVAQFADSGLRTSVQFVG
PLSVVDSALADQAEAVVREAVSNAVRHAKASTLTVRVKVDDDLCIEVTDNGRGLPDEFTG
SGLTNLRQRAEQAGGEFTLASVPGASGTVLRWSAPLSQ
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
PFAMP95194
Protein Data Bank2W3D 2W3E 2W3F 2W3G 2W3H 3ZXO 2Y79


Orthologs/Cross-references
CDC1551MT3218
Enzyme Classification2.7.13.3
Gene Ontologytwo-component sensor activity
two-component signal transduction system (phosphorelay)
ATP binding
cytoplasm
signal transduction
integral to membrane
peptidyl-histidine phosphorylation
metal ion binding
protein dimerization activity
M. bovisMb3156c
M. marinumMMAR_1517
M. smegmatisMSMEG_5241
UniProtP95194
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv3132c


Expression Data
TBDBRv3132c


Bibliography
Dasgupta N, Kapur V, Singh KK, Das TK, Sachdeva S, Jyothisri K, Tyagi JS,
Characterization of a two-component system, devR-devS, of Mycobacterium tuberculosis
Tuber Lung Dis (2000) 80(3):141-59
Cited for: Biochemistry/Regulation
Sherman DR, Voskuil M, Schnappinger D, Liao R, Harrell MI, Schoolnik GK,
Regulation of the Mycobacterium tuberculosis hypoxic response gene encoding alpha -crystallin
Proc Natl Acad Sci U S A (2001) 98(13):7534-9
Cited for: Transcriptome
Betts JC, Lukey PT, Robb LC, McAdam RA, Duncan K,
Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling
Mol Microbiol (2002) 43(3):717-31
Cited for: Transcriptome
Saini DK, Pant N, Das TK, Tyagi JS,
Cloning, Overexpression, Purification, and Matrix -Assisted Refolding of DevS (Rv 3132c) Histidine Protein Kinase of Mycobacterium tuberculosis
Protein Expr Purif (2002) 25(1):203-8
Cited for: Product/Function
M ayuri, Bagchi G, Das TK, Tyagi JS,
Molecular analysis of the dormancy response in Mycobacterium smegmatis: expression analysis of genes encoding the DevR-DevS two -component system, Rv3134c and chaperone alpha-crystallin homologues
FEMS Microbiol Lett (2002) 211(2):231-7
Cited for: Product/Transcriptome
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Park HD, Guinn KM, Harrell MI, Liao R, Voskuil MI, Tompa M, Schoolnik GK, Sherman DR,
Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis.
Mol Microbiol (2003) 48(3):833-843
Cited for: Transcriptome
Voskuil MI, Schnappinger D, Visconti KC, Harrell MI, Dolganov GM, Sherman DR, Schoolnik GK,
Inhibition of respiration by nitric oxide induces a Mycobacterium tuberculosis dormancy program.
J Exp Med (2003) 198(5):705-13
Cited for: Regulon
Gu S, Chen J, Dobos KM, Bradbury EM, Belisle JT, Chen X,
Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain.
Mol Cell Proteomics (2003) 2(12):1284-96
Cited for: Proteomics
Roberts DM, Liao RP, Wisedchaisri G, Hol WG, Sherman DR,
Two sensor kinases contribute to the hypoxic response of Mycobacterium tuberculosis.
J Biol Chem (2004) 279(22):23082-7
Cited for: Function
Saini DK, Malhotra V, Dey D, Pant N, Das TK, Tyagi JS,
DevR-DevS is a bona fide two-component system of Mycobacterium tuberculosis that is hypoxia-responsive in the absence of the DNA-binding domain of DevR.
Microbiology (Reading, Engl.) (2004) 150(Pt 4):865-75
Cited for: Function
Rengarajan J, Bloom BR, Rubin EJ,
Genome-wide requirements for Mycobacterium tuberculosis adaptation and survival in macrophages.
Proc Natl Acad Sci U S A (2005) 102(23):8327-32
Cited for: Mutant
Sardiwal S, Kendall SL, Movahedzadeh F, Rison SC, Stoker NG, Djordjevic S,
A GAF domain in the hypoxia/NO-inducible Mycobacterium tuberculosis DosS protein binds haem.
J Mol Biol (2005) 353(5):929-36
Cited for: Structure
Sousa EH, Tuckerman JR, Gonzalez G, Gilles-Gonzalez MA,
DosT and DevS are oxygen-switched kinases in Mycobacterium tuberculosis.
Protein Sci (2007) 16(8):1708-19
Cited for: Function
Kumar A, Toledo JC, Patel RP, Lancaster JR, Steyn AJ,
Mycobacterium tuberculosis DosS is a redox sensor and DosT is a hypoxia sensor.
Proc Natl Acad Sci U S A (2007) 104(28):11568-73
Cited for: Function
Zvi A, Ariel N, Fulkerson J, Sadoff JC, Shafferman A,
Whole genome identification of Mycobacterium tuberculosis vaccine candidates by comprehensive data mining and bioinformatic analyses.
BMC Med Genomics (2008) 1:18
Cited for: Immunology
Cho HY, Cho HJ, Kim YM, Oh JI, Kang BS,
Structural insight into the heme-based redox sensing by DosS from Mycobacterium tuberculosis.
J Biol Chem (2009) 284(19):13057-67
Cited for: Structure
Kelkar DS, Kumar D, Kumar P, Balakrishnan L, Muthusamy B, Yadav AK, Shrivastava P, Marimuthu A, Anand S, Sundaram H, Kingsbury R, Harsha HC, Nair B, Prasad TS, Chauhan DS, Katoch K, Katoch VM, Kumar P, Chaerkady R, Ramachandran S, Dash D, Pandey A,
Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
Mol Cell Proteomics (2011) 10(12):M111.011627
Cited for: Proteomics/Sequence
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant