Quick Search

Enter gene name or accession number


Search term: Rv3131

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv3131
Rv numberRv3131
TypeCDS
FunctionFunction unknown
ProductConserved protein
CommentsRv3131, (MTCY03A2.27c), len: 332 aa. Conserved protein, similar to other hypothetical bacterial proteins e.g. O53476|Rv2032|MTV018.19 (331 aa), FASTA scores: opt: 568, E(): 2.5e-27, (36.7% identity in 321 aa overlap); O05800|Rv3127|MTCY164.37 (344 aa), FASTA scores: opt: 521, E(): 1.9e-24, (34.95% identity in 326 aa overlap); Q9RI33|SCJ12.27c from Streptomyces coelicolor (335 aa), FASTA scores: opt: 441, E(): 1.3e-19, (35.75% identity in 319 aa overlap); Q9RI44|SCJ12.14 from Streptomyces coelicolor (309 aa), FASTA scores: opt: 328, E(): 9.3e-13, (27.9% identity in 308 aa overlap); Q9CBP5|ML1751 from Mycobacterium leprae (721 aa), FASTA scores: opt: 137, E(): 0.78, (26.15% identity in 298 aa overlap); etc. Equivalent to AAK47555 from Mycobacterium tuberculosis strain CDC1551 but shorter 12 aa. Predicted possible vaccine candidate (See Zvi et al., 2008).
Molecular mass (Da)35978.4
Isoelectric point7.0649
Gene length (bp)999
Protein length332
Location (kb)3496.55


Functional categoryconserved hypotheticals


ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the cytosol of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005).
TranscriptomemRNA identified by DNA microarray analysis: gene induced by hypoxia, and down-regulated after 4h of starvation (see citations below).
Mutationessential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website
RegulonPredicted to be in the DosR|Rv3133c regulon, in M. tuberculosis 1254 (See Voskuil et al., 2003).


Coordinates
TypeStartEndOrientation
RBS34965373496540+
CDS34965513497549+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv3131|Rv3131
MNTHFPDAETVRTVLTLAVRAPSIHNTQPWRWRVCPTSLELFSRPDMQLRSTDPDGRELI
LSCGVALHHCVVALASLGWQAKVNRFPDPKDRCHLATIGVQPLVPDQADVALAAAIPRRR
TDRRAYSCWPVPGGDIALMAARAARGGVMLRQVSALDRMKAIVAQAVLDHVTDEEYLREL
TIWSGRYGSVAGVPARNEPPSDPSAPIPGRLFAGPGLSQPSDVLPADDGAAILALGTETD
DRLARLRAGEAASIVLLTATAMGLACCPITEPLEIAKTRDAVRAEVFGAGGYPQMLLRVG
WAPINADPLPPTPRRELSQVVEWPEELLRQRC
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMP95195


Orthologs/Cross-references
CDC1551MT3217
Gene Ontologyoxidoreductase activity
oxidation reduction
M. bovisMb3155
M. smegmatisMSMEG_3955
UniProtP95195
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv3131


Expression Data
TBDBRv3131


Bibliography
Sherman DR, Voskuil M, Schnappinger D, Liao R, Harrell MI, Schoolnik GK,
Regulation of the Mycobacterium tuberculosis hypoxic response gene encoding alpha -crystallin
Proc Natl Acad Sci U S A (2001) 98(13):7534-9
Cited for: Transcriptome
Betts JC, Lukey PT, Robb LC, McAdam RA, Duncan K,
Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling
Mol Microbiol (2002) 43(3):717-31
Cited for: Transcriptome
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Park HD, Guinn KM, Harrell MI, Liao R, Voskuil MI, Tompa M, Schoolnik GK, Sherman DR,
Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis.
Mol Microbiol (2003) 48(3):833-843
Cited for: Transcriptome
Florczyk MA, McCue LA, Purkayastha A, Currenti E, Wolin MJ, McDonough KA,
A family of acr-coregulated Mycobacterium tuberculosis genes shares a common DNA motif and requires Rv3133c (dosR or devR) for expression.
Infect Immun (2003) 71(9):5332-43
Cited for: Regulation/Secondary
Voskuil MI, Schnappinger D, Visconti KC, Harrell MI, Dolganov GM, Sherman DR, Schoolnik GK,
Inhibition of respiration by nitric oxide induces a Mycobacterium tuberculosis dormancy program.
J Exp Med (2003) 198(5):705-13
Cited for: Regulon
Gu S, Chen J, Dobos KM, Bradbury EM, Belisle JT, Chen X,
Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain.
Mol Cell Proteomics (2003) 2(12):1284-96
Cited for: Proteomics
Mawuenyega KG, Forst CV, Dobos KM, Belisle JT, Chen J, Bradbury EM, Bradbury AR, Chen X,
Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling.
Mol Biol Cell (2005) 16(1):396-404
Cited for: Proteomics
Zvi A, Ariel N, Fulkerson J, Sadoff JC, Shafferman A,
Whole genome identification of Mycobacterium tuberculosis vaccine candidates by comprehensive data mining and bioinformatic analyses.
BMC Med Genomics (2008) 1:18
Cited for: Immunology