Quick Search

Enter gene name or accession number


Search term: Rv3129

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv3129
Rv numberRv3129
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv3129, (MTCY164.40), len: 110 aa. Conserved hypothetical protein, with some similarity to various hypothetical proteins from Streptomyces coelicolor e.g. Q9RI34|SCJ12.26 hypothetical 14.5 KDA protein (137 aa), FASTA scores: opt: 141, E(): 0.0016, (39.3% identity in 84 aa overlap); Q9RI49|SCJ12.09c hypothetical 15.8 KDA protein (146 aa), FASTA scores: opt: 141, E(): 0.0017, (38.05% identity in 92 aa overlap); Q9RJ05|SCJ1.09C possible DNA-binding protein (233 aa), FASTA scores: opt: 140, E(): 0.0029, (34.85% identity in 89 aa overlap); Q9XA48|SCGD3.31c putative branched-chain alpha keto acid dehydrogenase E1 beta subunit (334 aa); etc.
Molecular mass (Da)12258.9
Isoelectric point8.9752
Gene length (bp)333
Protein length110
Location (kb)3494.66


Functional categoryconserved hypotheticals


TranscriptomemRNA identified by DNA microarray analysis (gene induced by hypoxia) (see citation below).
Mutation Check for mutants available at TARGET website
RegulonPredicted to be in the DosR|Rv3133c regulon, in M. tuberculosis 1254 (See Voskuil et al., 2003).


Coordinates
TypeStartEndOrientation
CDS34946603494992+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv3129|Rv3129
VVQGRTVLFRTAEGAKLFSAVAKCAVAFEADDHNVAEGWSVIVKVRAQVLTTDAGVREAE
RAQLLPWTATLKRHCVRVIPWEITGRHFRFGPEPDRSQTFACEASSHNQR
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
CDC1551MT3215
M. bovisMb3153
M. marinumMMAR_1521
M. smegmatisMSMEG_6368
UniProtQ7D628
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv3129


Expression Data
TBDBRv3129


Bibliography
Sherman DR, Voskuil M, Schnappinger D, Liao R, Harrell MI, Schoolnik GK,
Regulation of the Mycobacterium tuberculosis hypoxic response gene encoding alpha -crystallin
Proc Natl Acad Sci U S A (2001) 98(13):7534-9
Cited for: Transcriptome
Park HD, Guinn KM, Harrell MI, Liao R, Voskuil MI, Tompa M, Schoolnik GK, Sherman DR,
Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis.
Mol Microbiol (2003) 48(3):833-843
Cited for: Transcriptome
Voskuil MI, Schnappinger D, Visconti KC, Harrell MI, Dolganov GM, Sherman DR, Schoolnik GK,
Inhibition of respiration by nitric oxide induces a Mycobacterium tuberculosis dormancy program.
J Exp Med (2003) 198(5):705-13
Cited for: Regulon