Quick Search

Enter gene name or accession number


Search term: Rv3062

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameligB
Rv numberRv3062
TypeCDS
FunctionThis protein seals during DNA replication, DNA recombination and DNA repair NICKS in double-stranded DNA [catalytic activity: ATP + (deoxyribonucleotide)(N) + (deoxyribonucleotide)(M) = AMP + pyrophosphate + (deoxyribonucleotide)(N+M)].
ProductProbable ATP-dependent DNA ligase LigB (polydeoxyribonucleotide synthase [ATP]) (polynucleotide ligase [ATP]) (sealase) (DNA repair protein) (DNA joinase)
CommentsRv3062, (MTCY22D7.19c), len: 507 aa. Probable ligB, DNA ligase ATP-dependent (see citation below), highly similar to numerous archaebacterial and eukaryotic polynucleotide DNA ligases, e.g. Q9FCB1|DNLI_STRCO|LIG|2SCG58.02 from Streptomyces coelicolor (512 aa), FASTA scores: opt: 1677, E(): 2.5e-90, (55.65% identity in 512 aa overlap); Q9HR35|DNLI_HALN1|LIG|VNG0881G from Halobacterium sp. strain NRC-1 (561 aa), FASTA scores: opt: 985, E(): 5.6e-50, (42.25% identity in 440 aa overlap); Q9V185|DNLI_PYRAB|LIG|PAB2002 from Pyrococcus abyssi (559 aa), FASTA scores: opt: 978, E(): 1.4e-49, (39.05% identity in 443 aa overlap); etc. Also similar to Rv3731|MTV025.079|LIGC possible DNA ligase from M. tuberculosis (358 aa). Similarity at N-terminus is poor so first start codon was taken. Contains (PS00697) ATP-dependent DNA ligase AMP-binding site signature, and (PS00017) ATP/GTP-binding site motif A (P-loop). Belongs to the ATP-dependent DNA ligase family.
Molecular mass (Da)53704.6
Isoelectric point9.5922
Gene length (bp)1524
Protein length507
Location (kb)3425.58


Functional categoryinformation pathways


ProteomicsIdentified in the cell wall fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005).
MutationNon-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Non essential gene in M. tuberculosis Erdman (See Gong et al., 2004). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS34255843427107+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv3062|ligB
VLLHDVAITSMDVAATSSRLTKVARIAALLHRAAPDTQLVTIIVSWLSGELPQRHIGVGW
AALRSLPPPAPQPALTVTGVDATLSKIGTLPGKGSQAQRAALVAELFSAATEAEQTFLLR
LLGGELRQGAKGGIMADAVAQAAGLPAATVQRAAMLGGDLAAAAAAGLSGAALDTFTLRV
GRPIGPMLAQTATSVHDALERHGGTTIFEAKLDGARVQIHRANDQVRIYTRSLDDVTARL
PEVVEATLALPVRDLVADGEAIALCPDNRPQRFQVTASRFGRSVDVAAARATQPLSVFFF
DILHRDGTDLLEAPTTERLAALDALVPARHRVDRLITSDPTDAANFLDATLAAGHEGVMA
KAPAARYLAGRRGAGWLKVKPVHTLDLVVLAVEWGSGRRRGKLSNIHLGARDPATGGFVM
VGKTFKGMTDAMLDWQTTRFHEIAVGPTDGYVVQLRPEQVVEVALDGVQRSSRYPGGLAL
RFARVVRYRADKDPAEADTIDAVRALY
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMP95096


Orthologs/Cross-references
CDC1551MT3148
Enzyme Classification6.5.1.1
Gene OntologyDNA binding
DNA ligase (ATP) activity
ATP binding
DNA replication
DNA repair
DNA recombination
cell cycle
metal ion binding
cell division
M. bovisMb3089
M. lepraeML1747
M. marinumMMAR_1623
M. smegmatisMSMEG_2277
UniProtP95096
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv3062


Expression Data
TBDBRv3062


Bibliography
Gong C, Martins A, Bongiorno P, Glickman M, Shuman S,
Biochemical and genetic analysis of the four DNA ligases of mycobacteria.
J Biol Chem (2004) 279(20):20594-606
Cited for: Biochemistry/Function/Mutant
Mawuenyega KG, Forst CV, Dobos KM, Belisle JT, Chen J, Bradbury EM, Bradbury AR, Chen X,
Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling.
Mol Biol Cell (2005) 16(1):396-404
Cited for: Proteomics
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant
Mizrahi V, Andersen SJ,
DNA repair in Mycobacterium tuberculosis. What have we learnt from the genome sequence?
Mol Microbiol (1998) 29(6):1331-9
Cited for: Secondary/Function