Quick Search

Enter gene name or accession number


Search term: Rv2918c

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameglnD
Rv numberRv2918c
TypeCDS
FunctionModifies, by uridylylation or deuridylylation the PII (GLNB|Rv2919c) regulatory protein [catalytic activity: UTP + [protein-PII] = diphosphate + uridylyl-[protein-PII]].
ProductProbable [protein-PII] uridylyltransferase GlnD (PII uridylyl- transferase) (uridylyl removing enzyme) (UTASE)
CommentsRv2918c, (MTCY338.07c), len: 808 aa. Probable glnD, uridylyltransferase (ala-rich protein), similar to other uridylyltransferases e.g. O69873||SC2E1.02 from Streptomyces coelicolor (835 aa), FASTA scores: opt: 1473, E(): 2.8e-81, (41.03% identity in 858 aa overlap); P43919|GLND_HAEIN from Haemophilus influenzae (863 aa), FASTA scores: opt: 333, E(): 2.5e-12, (25.4% identity in 819 aa overlap); P27249|GLND_ECOLI|GLND|B0167 from Escherichia coli strain K12 (890 aa), FASTA scores: opt: 306, E(): 1.1e-10, (27.75% identity in 858 aa overlap); etc. Belongs to the GlnD family.
Molecular mass (Da)86437.8
Isoelectric point5.6691
Gene length (bp)2427
Protein length808
Location (kb)3228.25


Functional categoryintermediary metabolism and respiration


ProteomicsIdentified in the cell wall and cell membrane fractions of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005).
Mutationnon essential gene by Himar1-based transposon mutagenesis in CDC1551 strain (see Lamichhane et al., 2003). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS32282543230680-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv2918c|glnD
MEAESPCAASDLAVARRELLSGNHRELDPVGLRQTWLDLHESWLIDKADEIGIADASGFA
IVGVGGLGRRELLPYSDLDVLLLHDGKPADILRPVADRLWYPLWDANIRLDHSVRTVSEA
LTIANSDLMAALGMLEARHIAGDQQLSFALIDGVRRQWRNGIRSRMGELVEMTYARWRRC
GRIAQRAEPDLKLGRGGLRDVQLLDALALAQLIDRHGIGHTDLPAGSLDGAYRTLLDVRT
ELHRVSGRGRDHLLAQFADEISAALGFGDRFDLARTLSSAGRTIGYHAEAGLRTAANALP
RRGISALVRRPKRRPLDEGVVEYAGEIVLARDAEPEHDPGLVLRVAAASADTGLPIGAAT
LSRLAASVPDLPTPWPQEALDDLLVVLSAGPTTVATIEALDRTGLWGRLLPEWEPIRDLP
PRDVAHKWTVDRHVVETAVHAAPLATRVARPDLLALGALLHDIGKGRGTDHSVLGAELVI
PVCTRLGLSPPDVRTLSKLVRHHLLLPITATRRDLNDPKTIEAVSEALGGDPQLLEVLHA
LSEADSKATGPGVWSDWKASLVDDLVRRCRMVMAGESLPQAEPTAPHYLSLAADHGVHVE
ISPRDGERIDAVIVAPDERGLVSKAAAVLALNSLRVHSASVNVHQGVAITEFVVSPLFGS
PPAAELVRQQFVGALNGDVDVLGMLQKRDSDAASLVSARAGDVQAGVPVTRTAAPPRILW
LDTAAPAKLILEVRAMDRAGLLALLAGALEGAGAGIVWAKVNTFGSTAADVFCVTVPAEL
DARAAVEQHLLEVLGASVDVVVDEPVGD
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMQ10961


Orthologs/Cross-references
CDC1551MT2986
Enzyme Classification2.7.7.59
Gene Ontologynitrogen compound metabolic process
[protein-PII] uridylyltransferase activity
amino acid binding
M. bovisMb2942c
M. lepraeML1625
M. marinumMMAR_1789
M. smegmatisMSMEG_2427
UniProtQ10961
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv2918c


Expression Data
TBDBRv2918c


Bibliography
Lamichhane G, Zignol M, Blades NJ, Geiman DE, Dougherty A, Grosset J, Broman KW, Bishai WR,
A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis.
Proc Natl Acad Sci U S A (2003) 100(12):7213-8
Cited for: Mutant
Mawuenyega KG, Forst CV, Dobos KM, Belisle JT, Chen J, Bradbury EM, Bradbury AR, Chen X,
Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling.
Mol Biol Cell (2005) 16(1):396-404
Cited for: Proteomics