Quick Search

Enter gene name or accession number


Search term: Rv2917

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv2917
Rv numberRv2917
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical alanine and arginine rich protein
CommentsRv2917, (MTCY338.05), len: 626 aa. Conserved hypothetical ala-, arg-rich protein, highly similar (but longer 34 aa) to O33011|ML1624|MLCB250.18C hypothetical 65.2 KDA protein from Mycobacterium leprae (596 aa), FASTA scores: opt: 3117, E(): 9e-183, (79.8% identity in 584 aa overlap). Also highly similar to Q9S2E8|SCE19A.36C hypothetical 66.2 KDA protein from Streptomyces coelicolor (598 aa), FASTA scores: opt: 1921, E(): 1.1e-109, (56.08% identity in 567 aa overlap); and Q9S3Y6|SDRA SDRA protein from Streptomyces coelicolor (597 aa), FASTA scores: opt: 1896, E(): 3.6e-108, (55.75% identity in 567 aa overlap). And shows some similarity with others proteins from other organisms. Equivalent to AAK47311 putative RNA helicase from Mycobacterium tuberculosis strain CDC1551 (602 aa) but longer 24 aa. Contains PS00017 ATP/GTP-binding site motif A (P-loop).
Molecular mass (Da)68333.7
Isoelectric point9.5558
Gene length (bp)1881
Protein length626
Location (kb)3226.36


Functional categoryconserved hypotheticals
Prediction based on GO and InterPro: cell wall and cell processes (See Mazandu and Mulder, 2012)


ProteomicsIdentified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS32263633228243+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv2917|Rv2917
VRVTRLVDAESTRCDVGPAPKSVAMLHFTAATSRFRLGRERANSVRSDGGWGVLQPVSAT
FNPPLRGWQRRALVQYLGTQPRDFLAVATPGSGKTSFALRIAAELLRYHTVEQVTVVVPT
EHLKVQWAHAAAAHGLSLDPKFANSNPQTSPEYHGVMVTYAQVASHPTLHRVRTEARKTL
VVFDEIHHGGDAKTWGDAIREAFGDATRRLALTGTPFRSDDSPIPFVSYQPDADGVLRSQ
ADHTYGYAEALADGVVRPVVFLAYSGQARWRDSAGEEYEARLGEPLSAEQTARAWRTALD
PEGEWMPAVITAADRRLRQLRAHVPDAGGMIIASDRTTARAYARLLTTMTAEEPTVVLSD
DPGSSARITEFAQGTSRWLVAVRMVSEGVDVPRLSVGVYATNASTPLFFAQAIGRFVRSR
RPGETASIFVPSVPNLLQLASALEVQRNHVLGRPHRESAHDPLDGDPATRTQTERGGAER
GFTALGADAELDQVIFDGSSFGTATPTGSDEEADYLGIPGLLDAEQMRALLHRRQDEQLR
KRAQLQKGATQPATSGASASVHGQLRDLRRELHTLVSIAHHRTGKPHGWIHDERRRRCGG
PPIAAATRAQIKARIDALRQLNSERS
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMQ10966


Orthologs/Cross-references
CDC1551MT2985
Gene OntologyDNA binding
ATP binding
nucleoside-triphosphatase activity
M. bovisMb2941
M. lepraeML1624
M. marinumMMAR_1790
M. smegmatisMSMEG_0866
UniProtQ10966
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv2917


Expression Data
TBDBRv2917


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Mawuenyega KG, Forst CV, Dobos KM, Belisle JT, Chen J, Bradbury EM, Bradbury AR, Chen X,
Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling.
Mol Biol Cell (2005) 16(1):396-404
Cited for: Proteomics
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant
Mazandu GK, Mulder NJ,
Function Prediction and Analysis of Mycobacterium tuberculosis Hypothetical Proteins.
Int J Mol Sci (2012) 13(6):7283-302
Cited for: Function