Quick Search

Enter gene name or accession number


Search term: Rv2915c

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv2915c
Rv numberRv2915c
TypeCDS
FunctionFunction unknown
ProductConserved protein
CommentsRv2915c, (MTCY338.03c), len: 370 aa. Conserved protein, posssibly XAA-pro dipeptidase (prolidase), highly similar to CAC38796|SCI39.08c conserved hypothetical protein from Streptomyces coelicolor (363 aa), FASTA scores: opt: 1341, E(): 5.5e-76, (56.65% identity in 362 aa overlap); and similar to prolidases (XAA-pro dipeptidase) e.g. Q9ABC9|CC0300 putative XAA-pro dipeptidase from Caulobacter crescentus (428 aa), FASTA scores: opt: 327, E(): 7.4e-13, (30.2% identity in 374 aa overlap); Q97XD4 prolidase from Sulfolobus solfataricus (396 aa), FASTA scores: opt: 271, E(): 2.1e-09, (30.5% identity in 354 aa overlap); Q9WX55 prolidase from Microbacterium esteraromaticum (393 aa), FASTA scores: opt: 256, E(): 1.8e-08, (27.95% identity in 365 aa overlap); etc. Also similar to O53619|Rv0074|MTV030.18 conserved hypothetical protein from Mycobacterium tuberculosis (411 aa), FASTA scores: opt: 243, E(): 1.2e-07, (27.5% identity in 389 aa overlap).
Molecular mass (Da)39737.8
Isoelectric point5.2533
Gene length (bp)1113
Protein length370
Location (kb)3223.57


Functional categoryconserved hypotheticals
Prediction based on GO and InterPro: intermediary metabolism and respiration (See Mazandu and Mulder, 2012)


ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS32235683224680-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv2915c|Rv2915c
VKRVDTIRPRSRAVRLHVRGLGLPDETAIQLWIVDGRISTEPVAGADTVFDGGWILPGLV
DAHCHVGLGKHGNVELDEAIAQAETERDVGALLLRDCGSPTDTRGLDDHEDLPRIIRAGR
HLARPKRYIAGFAVELEDESQLPAAVAEQARRGDGWVKLVGDWIDRQIGDLAPLWSDDVL
KAAIDTAHAQGARVTAHVFSEDALPGLINAGIDCIEHGTGLTDDTIALMLEHGTALVPTL
INLENFPGIADAAGRYPTYAAHMRDLYARGYGRVAAAREAGVPVYAGTDAGSTIEHGRIA
DEVAALQRIGMTAHEALGAACWDARRWLGRPGLDDRASADLLCYAQDPRQGPGVLQHPDL
VILRGRTFGP
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMP68917


Orthologs/Cross-references
Gene Ontologyhydrolase activity
M. bovisMb2939c
M. lepraeML1621
UniProtP68917
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv2915c


Expression Data
TBDBRv2915c


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Malen H, Pathak S, Softeland T, de Souza GA, Wiker HG,
Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv.
BMC Microbiol (2010) 10:132
Cited for: Proteomics
Kruh NA, Troudt J, Izzo A, Prenni J, Dobos KM,
Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo.
PLoS One (2010) 5(11):e13938
Cited for: Proteomics
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant
Mazandu GK, Mulder NJ,
Function Prediction and Analysis of Mycobacterium tuberculosis Hypothetical Proteins.
Int J Mol Sci (2012) 13(6):7283-302
Cited for: Function