Quick Search

Enter gene name or accession number


Search term: Rv2913c

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv2913c
Rv numberRv2913c
TypeCDS
FunctionHydrolyzes specific D-amino acid.
ProductPossible D-amino acid aminohydrolase (D-amino acid hydrolase)
CommentsRv2913c, (MTCY338.01c, MTCY274.45c), len: 611 aa. Possible D-amino acid aminohydrolase, similar (principally in N-terminus) to D-amino acid aminohydrolases e.g. Q9V2D3|NDAD|PAB0090 D-aminoacylase (aspartate, glutamate etc) from Pyrococcus abyssi (526 aa), FASTA scores: opt: 336, E(): 2.2e-13, (27.55% identity in 581 aa overlap); P94212|NDDD_ALCXX N-acyl-D-aspartate deacylase (N-acyl-D-aspartate amidohydrolase) from Alcaligenes xylosoxydans xylosoxydans (Achromobacter xylosoxidans) (498 aa), FASTA scores: opt: 221, E(): 3.4e-06, (25.95% identity in 532 aa overlap); Q9AGH8 D-aminoacylase from Alcaligenes faecalis (484 aa), FASTA scores: opt: 218, E(): 5.1e-06, (28.35% identity in 434 aa overlap); etc.
Molecular mass (Da)67205.2
Isoelectric point6.4198
Gene length (bp)1836
Protein length611
Location (kb)3219.86


Functional categoryintermediary metabolism and respiration


ProteomicsIdentified in the cytosol of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
TranscriptomemRNA identified by DNA microarray analysis and up-regulated at high temperatures (see citation below).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS32198633221698-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv2913c|Rv2913c
MLAWRQLNDLEETVTYDVIIRDGLWFDGTGNAPLTRTLGIRDGVVATVAAGALDETGCPE
VVDAAGKWVVPGFIDVHTHYDAEVLLDPGLRESVRHGVTTVLLGNCSLSTVYANSEDAAD
LFSRVEAVPREFVLGALRDNQTWSTPAEYIEAIDALPLGPNVSSLLGHSDLRTAVLGLDR
ATDDTVRPTEAELAKMAKLLDEALEAGMLGMSGMDAAIDKLDGDRFRSRALPSTFATWRE
RRKLISVLRHRGRILQSAPDVDNPVSALLFFLASSRIFNRRKGVRMSMLVSADAKSMPLA
VHVFGLGTRVLNKLLGSQVRFQHLPVPFELYSDGIDLPVFEEFGAGTAALHLRDQLQRNE
LLADRSYRRSFRREFDRIKLGPSLWHRDFHDAVIVECPDKSLIGKSFGAIADERGLHPLD
AFLDVLVDNGERNVRWTTIVANHRPNQLNKLAAEPSVHMGFSDAGAHLRNMAFYNFGLRL
LKRARDADRAGQPFLSIERAVYRLTGELAEWFGIGAGTLRQGDRADFAVIDPTHLDESVD
GYHEEAVPYYGGLRRMVNRNDATVVATGVGGTVVFRGGQFGGQFRDGYGQNVKSGRYLRA
GELGAALSRSA
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMP65530


Orthologs/Cross-references
CDC1551MT2981
Gene Ontologyhydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
M. bovisMb2937c
M. marinumMMAR_1795
M. smegmatisMSMEG_6141
UniProtP65530
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv2913c


Expression Data
TBDBRv2913c


Bibliography
Stewart GR, Wernisch L, Stabler R, Mangan JA, Hinds J, Laing KG, Young DB, Butcher PD,
Dissection of the heat-shock response in Mycobacterium tuberculosis using mutants and microarrays
Microbiology (2002) 148(Pt 10):3129-3138
Cited for: Transcriptome/Mutant/Regulation
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Lamichhane G, Zignol M, Blades NJ, Geiman DE, Dougherty A, Grosset J, Broman KW, Bishai WR,
A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis.
Proc Natl Acad Sci U S A (2003) 100(12):7213-8
Cited for: Mutant
Mawuenyega KG, Forst CV, Dobos KM, Belisle JT, Chen J, Bradbury EM, Bradbury AR, Chen X,
Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling.
Mol Biol Cell (2005) 16(1):396-404
Cited for: Proteomics
Malen H, Pathak S, Softeland T, de Souza GA, Wiker HG,
Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv.
BMC Microbiol (2010) 10:132
Cited for: Proteomics
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics