Quick Search

Enter gene name or accession number


Search term: Rv2912c

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv2912c
Rv numberRv2912c
TypeCDS
FunctionThought to be involved in transcriptional mechanism.
ProductProbable transcriptional regulatory protein (probably TetR-family)
CommentsRv2912c, (MTCY274.44c), len: 195 aa. Probable transcription regulatory protein, TetR family, showing similarity with others e.g. Q9K3V9|SCD10.17 putative TetR-family transcriptional from Streptomyces coelicolor (202 aa), FASTA scores: opt: 185, E(): 4.4e-05, (31.15% identity in 167 aa overlap); Q9KFQ0 TetR-family from Bacillus halodurans (185 aa), FASTA scores: opt: 164, E(): 0.001, (35.6% identity in 73 aa overlap); P17446|BETI_ECOLI|BETI|B0313 regulatory protein from Escherichia coli strain K12 (195 aa), FASTA scores: opt: 126, E(): 0.024, (24.5% identity in 196 aa overlap); etc. Contains possible helix-turn-helix motif at aa 33-54 (+2.71 SD). Possibly belongs to the TetR/AcrR family.
Molecular mass (Da)21238.5
Isoelectric point5.3413
Gene length (bp)588
Protein length195
Location (kb)3219.27


Functional categoryregulatory proteins


ProteomicsIdentified in the cytosol of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
TranscriptomemRNA identified by DNA microarray analysis and up-regulated at high temperatures (see citation below).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS32192743219861-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv2912c|Rv2912c
MARTQQQRREETVARLLQASIDTIIEVGYARASAAVITKRAGVSVGALFRHFETMGDFMA
ATAYEVLRRQLETFTKQVAEIPADRPALPAALTILRDITAGSTNAVLYELMVAARTDEKL
KETLQNVLGQYSAKIHDAARALPGAESFPEETFPVIVALMTNVFDGAAIVRGVLPQPELE
EQRIPMLTALLTAGL
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMP67440


Orthologs/Cross-references
CDC1551MT2980
Gene Ontologytranscription factor activity
transcription
regulation of transcription, DNA-dependent
M. bovisMb2936c
M. marinumMMAR_1796
M. smegmatisMSMEG_6139
UniProtP67440
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv2912c


Expression Data
TBDBRv2912c


Bibliography
Stewart GR, Wernisch L, Stabler R, Mangan JA, Hinds J, Laing KG, Young DB, Butcher PD,
Dissection of the heat-shock response in Mycobacterium tuberculosis using mutants and microarrays
Microbiology (2002) 148(Pt 10):3129-3138
Cited for: Transcriptome/Mutant/Regulation
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Sassetti CM, Rubin EJ,
Genetic requirements for mycobacterial survival during infection.
Proc Natl Acad Sci U S A (2003) 100(22):12989-94
Cited for: Mutant
Mawuenyega KG, Forst CV, Dobos KM, Belisle JT, Chen J, Bradbury EM, Bradbury AR, Chen X,
Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling.
Mol Biol Cell (2005) 16(1):396-404
Cited for: Proteomics
Malen H, Pathak S, Softeland T, de Souza GA, Wiker HG,
Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv.
BMC Microbiol (2010) 10:132
Cited for: Proteomics
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics