Quick Search

Enter gene name or accession number


Search term: Rv2910c

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv2910c
Rv numberRv2910c
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv2910c, (MTCY274.42c), len: 147 aa. Conserved hypothetical protein, showing some similarity with hypothetical proteins from other organisms e.g. Q9JN76|MMYY hypothetical 17.4 KDA protein from Streptomyces coelicolor (153 aa), FASTA scores: opt: 164, E(): 0.00026, (35.05% identity in 129 aa overlap); etc. Also some similarity with protein from Mycobacterium tuberculosis e.g. O07237|Rv0310c|MTCY63.15c (163 aa), FASTA scores: opt: 165, E(): 0.00023, (26.3% identity in 137 aa overlap); P96815|Rv0138|MTCI5.12 (167 aa), FASTA scores: opt: 132, E(): 0.048, (30.25% identity in 109 aa overlap); etc.
Molecular mass (Da)17048.6
Isoelectric point5.2026
Gene length (bp)444
Protein length147
Location (kb)3217.83


Functional categoryconserved hypotheticals
Prediction based on GO and InterPro: information pathways (See Mazandu and Mulder, 2012)


ProteomicsIdentified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS32178273218270-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv2910c|Rv2910c
MCAVLDRSMLSVAEISDRLEIQQLLVDYSSAIDQRRFDDLDRVFTPDAYIDYRALGGIDG
RYPKIKQWLSQVLGNFPVYAHMLGNFSVRVDGDTASSRVICFNPMVFAGDRQQVLFCGLW
YDDDFVRTPDGWRIIRRVETKCFQKMM
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
CDC1551MT2978
M. bovisMb2934c
M. lepraeML1619
M. marinumMMAR_1798
M. smegmatisMSMEG_2434
UniProtP65053
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv2910c


Expression Data
TBDBRv2910c


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Lamichhane G, Zignol M, Blades NJ, Geiman DE, Dougherty A, Grosset J, Broman KW, Bishai WR,
A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis.
Proc Natl Acad Sci U S A (2003) 100(12):7213-8
Cited for: Mutant
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant
Mazandu GK, Mulder NJ,
Function Prediction and Analysis of Mycobacterium tuberculosis Hypothetical Proteins.
Int J Mol Sci (2012) 13(6):7283-302
Cited for: Function