|  |
| To navigate upstream or downstream, click on the first or last gene |
| Functional category | cell wall and cell processes |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS; predicted integral membrane protein (See Xiong et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 90 days but not 30 days (See Kruh et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Transcriptome | mRNA identified by microarray analysis and down-regulated after 24h and 96h of starvation (see Betts et al., 2002). |
| Mutation | essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
| Regulon | Predicted to be in the RelA|Rv2583c regulon (See Dahl et al., 2003). |
| Coordinates | |||
|---|---|---|---|
| Type | Start | End | Orientation | CDS | 3212970 | 3213854 | - |
| Protein sequence in FASTA format | ||
|---|---|---|
| >M. tuberculosis H37Rv|Rv2903c|lepB VTETTDSPSERQPGPAEPELSSRDPDIAGQVFDAAPFDAAPDADSEGDSKAAKTDEPRPA KRSTLREFAVLAVIAVVLYYVMLTFVARPYLIPSESMEPTLHGCSTCVGDRIMVDKLSYR FGSPQPGDVIVFRGPPSWNVGYKSIRSHNVAVRWVQNALSFIGFVPPDENDLVKRVIAVG GQTVQCRSDTGLTVNGRPLKEPYLDPATMMADPSIYPCLGSEFGPVTVPPGRVWVMGDNR THSADSRAHCPLLCTDDPLPGTVPVANVIGKARLIVWPPSRWGVVRSVNPQQGR | ||
| Blastp: Pre-computed results | ||
| TransMembrane prediction using Hidden Markov Models: TMHMM | ||
| Genomic sequence | ||
| Structural information | ||
|---|---|---|
| Protein Data Bank | No structure available | |
| PFAM | Q10789 | |
| Orthologs/Cross-references | ||
|---|---|---|
| CDC1551 | MT2971 | |
| Enzyme Classification | 3.4.21.89 | |
| Gene Ontology | plasma membrane proteolysis serine-type peptidase activity integral to membrane | |
| M. bovis | Mb2927c | |
| M. leprae | ML1612 | |
| M. marinum | MMAR_1805 | |
| M. smegmatis | MSMEG_2441 | |
| UniProt | Q10789 | |
| Multiple Sequences Alignment: between orthologs | ||
| Interacting Drugs/Compounds | ||
|---|---|---|
| TDR Targets | Rv2903c | |
| Expression Data | ||
|---|---|---|
| TBDB | Rv2903c | |
| Bibliography | ||
|---|---|---|
| Betts JC, Lukey PT, Robb LC, McAdam RA, Duncan K, Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling Mol Microbiol (2002) 43(3):717-31 Cited for: Transcriptome | ||
| Sassetti CM, Boyd DH, Rubin EJ, Genes required for mycobacterial growth defined by high density mutagenesis. Mol Microbiol (2003) 48(1):77-84 Cited for: Mutant | ||
| Dahl JL, Kraus CN, Boshoff HI, Doan B, Foley K, Avarbock D, Kaplan G, Mizrahi V, Rubin H, Barry CE 3rd, The role of RelMtb-mediated adaptation to stationary phase in long-term persistence of Mycobacterium tuberculosis in mice. Proc Natl Acad Sci U S A (2003) 100(17):10026-31 Cited for: Regulon | ||
| Xiong Y, Chalmers MJ, Gao FP, Cross TA, Marshall AG, Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. J Proteome Res (2005) 4(3):855-61 Cited for: Proteomics | ||
| Ribeiro-Guimaraes ML, Pessolani MC, Comparative genomics of mycobacterial proteases. Microb Pathog (2007) 43(5-6):173-8 Cited for: Homology | ||
| Malen H, Pathak S, Softeland T, de Souza GA, Wiker HG, Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. BMC Microbiol (2010) 10:132 Cited for: Proteomics | ||
| Kruh NA, Troudt J, Izzo A, Prenni J, Dobos KM, Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. PLoS One (2010) 5(11):e13938 Cited for: Proteomics | ||
| de Souza GA, Leversen NA, Malen H, Wiker HG, Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. J Proteomics (2011) 75(2):502-10 Cited for: Proteomics | ||
| Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM, High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. PLoS Pathog (2011) 7(9):e1002251 Cited for: Mutant | ||
| Braunstein M, Belisle JT, Molecular Genetics of Mycobacteria; Thirteenth chapter: Genetics of Protein Secretion ASM Press (2000) 1-55581-191-4:203-220 Cited for: Review | ||