Quick Search

Enter gene name or accession number


Search term: Rv2764c

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene namethyA
Rv numberRv2764c
TypeCDS
FunctionInvolved in deoxyribonucleotide biosynthesis. Provides the sole de novo source of dTMP for DANA biosynthesis [catalytic activity: 5,10-methylenetetrahydrofolate + dUMP = dihydrofolate + dTMP].
ProductProbable thymidylate synthase ThyA (ts) (TSASE)
CommentsRv2764c, (MTV002.29c), len: 263 aa. Probable thyA, thymidylate synthase, equivalent to Q9CBW0|TYSY_MYCLE|THYA|ML1519 thymidylate synthase from Mycobacterium leprae (266 aa), FASTA scores: opt: 1602, E(): 5.9e-102, (85.5% identity in 262 aa overlap). Also highly similar to many e.g. P00470|TYSY_ECOLI|B2827|Z4144|ECS3684|BAB37107|AAG57938 from Escherichia coli strains K12 and O157:H7 (264 aa), FASTA scores: opt: 1309, E(): 5.9e-82, (66.65% identity in 261 aa overlap); P48464|TYSY_SHIFL|THYA from Shigella flexneri (264 aa), FASTA scores: opt: 1303, E(): 1.5e-81, (65.9% identity in 261 aa overlap); P54081|TYSB_BACAM|THYB|THYBA from Bacillus amyloliquefaciens (264 aa), FASTA scores: opt: 1235, E(): 6.7e-77, (66.65% identity in 261 aa overlap); etc. Contains PS00091 Thymidylate synthase active site. Belongs to the thymidylate synthase family.
Molecular mass (Da)29820.8
Isoelectric point5.5428
Gene length (bp)792
Protein length263
Location (kb)3073.68


Functional categoryintermediary metabolism and respiration


TranscriptomemRNA identified by DNA microarray analysis and possibly down-regulated by hspR|Rv0353 (see Stewart et al., 2002).
MutationEssential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS30736803074471-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv2764c|thyA
VTPYEDLLRFVLETGTPKSDRTGTGTRSLFGQQMRYDLSAGFPLLTTKKVHFKSVAYELL
WFLRGDSNIGWLHEHGVTIWDEWASDTGELGPIYGVQWRSWPAPSGEHIDQISAALDLLR
TDPDSRRIIVSAWNVGEIERMALPPCHAFFQFYVADGRLSCQLYQRSADLFLGVPFNIAS
YALLTHMMAAQAGLSVGEFIWTGGDCHIYDNHVEQVRLQLSREPRPYPKLLLADRDSIFE
YTYEDIVVKNYDPHPAIKAPVAV
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
PFAMP67044
Protein Data Bank3QJ7


Orthologs/Cross-references
CDC1551MT2834
Enzyme Classification2.1.1.45
Gene Ontologythymidylate synthase activity
cytoplasm
dTMP biosynthetic process
M. lepraeML1519
M. marinumMMAR_1956
M. smegmatisMSMEG_2670
UniProtP67044
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv2764c


Expression Data
TBDBRv2764c


Bibliography
Stewart GR, Wernisch L, Stabler R, Mangan JA, Hinds J, Laing KG, Young DB, Butcher PD,
Dissection of the heat-shock response in Mycobacterium tuberculosis using mutants and microarrays
Microbiology (2002) 148(Pt 10):3129-3138
Cited for: Transcriptome/Regulation
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant