Quick Search

Enter gene name or accession number


Search term: Rv2402

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv2402
Rv numberRv2402
TypeCDS
FunctionFunction unknown
ProductConserved protein
CommentsRv2402, (MTCY253.18c), len: 642 aa. Conserved protein, highly similar to others e.g. 9X8C4|SCE36.11c conserved hypothetical protein (fragment) from Streptomyces coelicolor (612 aa), FASTA scores: opt: 1283, E(): 6.5e-75, (41.9% identity in 623 aa overlap); Q9RJ38|SCI8.15 hypothetical 66.3 KDA protein from Streptomyces coelicolor (595 aa), FASTA scores: opt: 1152, E(): 1.7e-66, (39.9% identity in 622 aa overlap), Q9S223|CI51.17 hypothetical 68.4 KDA protein from Streptomyces coelicolor (612 aa), FASTA scores: opt: 1146, E(): 4.2e-66, (40.6% identity in 623 aa overlap); YAY3_SCHPO|Q10211|c4h3.03c hypothetical 74.5 kDa protein from Schizosaccharomyces pombe (Fission yeast) (649 aa) FASTA scores: opt: 999, E(): 1.3e-56, (35.0% identity in 642 aa overlap); etc. Contains possible helix-turn-helix motif, at aa 224-245 (+4.68 SD).
Molecular mass (Da)72734
Isoelectric point5.9643
Gene length (bp)1929
Protein length642
Location (kb)2698.53


Functional categoryconserved hypotheticals


ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS26985292700457+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv2402|Rv2402
MALSSSSPLRNPFPPIADYAFLSDWETTCLISPAGSVEWLCVPRPDSPSVFGAILDRSAG
HFRLGPYGVSVPSARRYLPGSLIMETTWQTHTGWLIVRDALVMGKWHDIERRSRTHRRTP
MDWDAEHILLRTVRCVSGTVELMMSCEPAFDYHRLGATWEYSAEAYGEAIARANTEPDAH
PTLRLTTNLRIGLEGREARARTRMKEGDDVFVALSWTKHPPPQTYDEAADKMWQTTECWR
QWINIGNFPDHPWRAYLQRSALTLKGLTYSPTGALLAASTTSLPETPRGERNWDYRYAWI
RDSTFALWGLYTLGLDREADDFFAFIADVSGANNNERHPLQVMYGVGGERSLVEAELHHL
SGYDHARPVRIGNGAYNQRQHDIWGSILDSFYLHAKSREQVPENLWPVLKRQVEEAIKHW
REPDRGIWEVRGEPQHFTSSKVMCWVALDRGAKLAERQGEKSYAQQWRAIADEIKADILE
HGVDSRGVFTQRYGDEALDASLLLVVLTRFLPPDDPRVRNTVLAIADELTEDGLVLRYRV
HETDDGLSGEEGTFTICSFWLVSALVEIGEVGRAKRLCERLLSFASPLLLYAEEIEPRSG
RHLGNFPQAFTHLALINAVVHVIRAEEEADSSGMFQPANAPM
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMP71741


Orthologs/Cross-references
CDC1551MT2474
Gene Ontologyglucan 1,4-alpha-glucosidase activity
polysaccharide metabolic process
M. bovisMb2425
M. lepraeML0612
M. marinumMMAR_3721
M. smegmatisMSMEG_4535
UniProtP71741
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv2402


Expression Data
TBDBRv2402


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Gu S, Chen J, Dobos KM, Bradbury EM, Belisle JT, Chen X,
Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain.
Mol Cell Proteomics (2003) 2(12):1284-96
Cited for: Proteomics
Mawuenyega KG, Forst CV, Dobos KM, Belisle JT, Chen J, Bradbury EM, Bradbury AR, Chen X,
Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling.
Mol Biol Cell (2005) 16(1):396-404
Cited for: Proteomics
Malen H, Pathak S, Softeland T, de Souza GA, Wiker HG,
Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv.
BMC Microbiol (2010) 10:132
Cited for: Proteomics
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant