Quick Search

Enter gene name or accession number


Search term: Rv2401A

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv2401A
Rv numberRv2401A
TypeCDS
FunctionUnknown
ProductPossible conserved membrane protein
CommentsRv2401A, len: 67 aa. Possible conserved membrane protein, highly similar, but with 29 aa shorter, to ML0614|AL583919_34|Q49760 from Mycobacterium leprae (95 aa), FASTA scores: opt: 297, E(): 3.6e-15, (67.7% identity in 65 aa overlap). Has hydrophobic stretch.
Molecular mass (Da)7402.83
Isoelectric point10.8914
Gene length (bp)204
Protein length67
Location (kb)2698.04


Functional categorycell wall and cell processes


Mutation Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS26980422698245-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv2401A|Rv2401A
VGPMNGFLSWWDGVELWLSGLPFALQALAVMPVVLALAYFTAALLDALLGRVIQLIRRAR
RPDQAPR
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
CDC1551MT2473
M. bovisMb2424c
M. lepraeML0614
M. marinumMMAR_3719
M. smegmatisMSMEG_4534
UniProtQ79FE4
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv2401A


Expression Data
TBDBRv2401A