Quick Search

Enter gene name or accession number


Search term: Rv2401

** Showing annotation for Rv2401. Did you mean: Rv2401A


General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene nameRv2401
Rv numberRv2401
TypeCDS
FunctionUnknown
ProductHypothetical protein
CommentsRv2401, (MTCY253.19c), len: 109 aa. Hypothetical unknown protein. Equivalent to AAK46768 from Mycobacterium tuberculosis strain CDC1551 (134 aa) but shorter 25 aa. N-terminus extended since first submission (previously 72 aa).
Molecular mass (Da)12205.6
Isoelectric point11.702
Gene length (bp)330
Protein length109
Location (kb)2697.73


Functional categoryconserved hypotheticals


ProteomicsIdentified in culture filtrates of M. tuberculosis H37Rv (See Malen et al., 2007).
Mutationnon essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS26977282698057+


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv2401|Rv2401
VRDFGQRSRSGGKAIAEHCRTHELHIRPRTGGESATTVQVGRSAANERADIAPRKTRCCV
HVAKPNRIRLADQLARSSMGEKPGHDHQRNQRDQNQRDVRPRHPGYLGA
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
CDC1551MT2472
M. bovisMb2423
UniProtO86326
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv2401


Expression Data
TBDBRv2401


Bibliography
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Malen H, Berven FS, Fladmark KE, Wiker HG,
Comprehensive analysis of exported proteins from Mycobacterium tuberculosis H37Rv.
Proteomics (2007) 7(10):1702-18
Cited for: Proteomics
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant