Quick Search

Enter gene name or accession number


Search term: Rv2400c

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene namesubI
Rv numberRv2400c
TypeCDS
FunctionInvolved in the active transport across the membrane of multiple sulfur-containing compounds, including sulfate and thiosulfate (import).
ProductProbable sulfate-binding lipoprotein SubI
CommentsRv2400c, (MTCY253.21), len: 356 aa. Probable subI, sulfate-binding lipoprotein component of sulfate transport system (see citations below), equivalent to Q9CCN3|SUBI|ML0615 (alias Q49748|B1937_F1_11, 358 aa) putative sulphate-binding protein from Mycobacterium leprae (348 aa), FASTA scores: opt: 1775, E(): 2.3e-102, (76.45% identity in 340 aa overlap). Also similar to others and other substrate-binding proteins e.g. P27366|SUBI_SYNP7|SBPA sulfate-binding protein precursor from Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) (350 aa), FASTA scores: opt: 703, E(): 4.6e-36, (35.6% identity in 351 aa overlap); Q9I6K7|SBP|PA0283 sulfate-binding protein precursor from Pseudomonas aeruginosa (332 aa), FASTA scores: opt: 591, E(): 3.7e-29, (36.9% identity in 317 aa overlap); CAC49112|SMB21133 putative sulfate uptake ABC transporter periplasmic solute-binding protein precursor from Rhizobium meliloti (Sinorhizobium meliloti) (341 aa), FASTA scores: opt: 569, E(): 8.8e-28, (36.15% identity in 321 aa overlap); etc. Belongs to the prokaryotic sulfate binding protein family.
Molecular mass (Da)37418.3
Isoelectric point6.7927
Gene length (bp)1071
Protein length356
Location (kb)2696.64


Functional categorycell wall and cell processes


ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS (See Xiong et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011).
TranscriptomemRNA identified by microarray analysis and up-regulated after 24h and 96h of starvation (see Betts et al., 2002).
Mutationessential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS26966442697714-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv2400c|subI
MLSLTLSEASCIASASRWRHIIPAGVVCALIAGIGVGCHGGPSDVVGRAGPDRAHTSITL
VAYAVPEPGWSAVIPAFNASEQGRGVQVITSYGASADQSRGVADGKPADLVNFSVEPDIA
RLVKAGKVDKDWDADATKGIPFGSVVTFVVRAGNPKNIRDWDDLLRPGIEVITPSPLSSG
SAKWNLLAPYAAKSDGGRNNQAGIDFVNTLVNEHVKLRPGSGREATDVFVQGSGDVLISY
ENEAIATERAGKPVQHVTPPQTFKIENPLAVVATSTHLGAATAFRNFQYTVQAQKLWAQA
GFRPVDPAVAADFADLFPVPAKLWTIADLGGWGSVDPQLFDKATGSITKIYLRATG
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Orthologs/Cross-references
CDC1551MT2471
Gene Ontologysulfate transport
sulfate transmembrane-transporting ATPase activity
outer membrane-bounded periplasmic space
M. bovisMb2422c
M. lepraeML0615
M. marinumMMAR_3718
M. smegmatisMSMEG_4533
UniProtP71744
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv2400c


Expression Data
TBDBRv2400c


Bibliography
Braibant M, Gilot P, Content J,
The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis
FEMS Microbiol Rev (2000) 24(4):449-67
Cited for: Review/Secondary
Wooff E, Michell SL, Gordon SV, Chambers MA, Bardarov S, Jacobs Jr WR, Hewinson RG, Wheeler PR,
Functional genomics reveals the sole sulphate transporter of the Mycobacterium tuberculosis complex and its relevance to the acquisition of sulphur in vivo
Mol Microbiol (2002) 43(3):653-63
Cited for: Homolog/Mutant/Function
Betts JC, Lukey PT, Robb LC, McAdam RA, Duncan K,
Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling
Mol Microbiol (2002) 43(3):717-31
Cited for: Transcriptome
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Xiong Y, Chalmers MJ, Gao FP, Cross TA, Marshall AG,
Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry.
J Proteome Res (2005) 4(3):855-61
Cited for: Proteomics
Malen H, Pathak S, Softeland T, de Souza GA, Wiker HG,
Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv.
BMC Microbiol (2010) 10:132
Cited for: Proteomics
de Souza GA, Leversen NA, Malen H, Wiker HG,
Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway.
J Proteomics (2011) 75(2):502-10
Cited for: Proteomics
Kelkar DS, Kumar D, Kumar P, Balakrishnan L, Muthusamy B, Yadav AK, Shrivastava P, Marimuthu A, Anand S, Sundaram H, Kingsbury R, Harsha HC, Nair B, Prasad TS, Chauhan DS, Katoch K, Katoch VM, Kumar P, Chaerkady R, Ramachandran S, Dash D, Pandey A,
Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
Mol Cell Proteomics (2011) 10(12):M111.011627
Cited for: Proteomics/Sequence
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant