Quick Search

Enter gene name or accession number


Search term: Rv2399c

General annotation | Coordinates | Sequence | Structural information | Orthologs/Cross-references | Interacting Drugs/Compounds | Bibliography
Imagemap from R
To navigate upstream or downstream, click on the first or last gene

General annotation
Gene namecysT
Rv numberRv2399c
TypeCDS
FunctionInvolved in the active transport across the membrane of multiple sulfur-containing compounds, including sulfate and thiosulfate (import). Responsible for the translocation of the substrate across the membrane.
ProductProbable sulfate-transport integral membrane protein ABC transporter CysT
CommentsRv2399c, (MTCY253.22), len: 283 aa. Probable cysT, sulfate-transport integral membrane protein ABC transporter (see citations below), similar to others e.g. BAB48989|MLR1667 permease protein of sulfate ABC transporter from Rhizobium loti (283 aa), FASTA scores: opt: 756, E(): 7.9e-40, (40.95% identity in 271 aa overlap); Q9K878|cyst|BH3128 sulfate ABC transporter (permease) from Bacillus halodurans (279 aa), FASTA scores: opt: 750, E(): 1.8e-39, (44.55% identity in 258 aa overlap); P16701|CYST_ECOLI|CYSU|cyst|B2424 from Escherichia coli (277 aa), FASTA scores: opt: 669, E(): 1.9e-34, (40.0% identity in 260 aa overlap); etc. Contains PS00402 Binding-protein-dependent transport systems inner membrane component signature, and PS00017 ATP/GTP-binding site motif A (P-loop). Belongs to the CYSTW subfamily.
Molecular mass (Da)29682.9
Isoelectric point9.9977
Gene length (bp)852
Protein length283
Location (kb)2695.8


Functional categorycell wall and cell processes


TranscriptomemRNA identified by microarray analysis and up-regulated after 24h and 96h of starvation (see Betts et al., 2002).
Mutationessential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website


Coordinates
TypeStartEndOrientation
CDS26957962696647-


Protein sequence in FASTA format
>M. tuberculosis H37Rv|Rv2399c|cysT
MTESLVGERRAPQFRARLSGPAGPPSVRVGMAVVWLSVIVLLPLAAIVWQAAGGGWRAFW
LAVSSHAAMESFRVTLTISTAVTVINLVFGLLIAWVLVRDDFAGKRIVDAIIDLPFALPT
IVASLVMLALYGNNSPVGLHFQHTATGVGVALAFVTLPFVVRAVQPVLLEIDRETEEAAA
SLGANGAKIFTSVVLPSLTPALLSGAGLAFSRAIGEFGSVVLIGGAVPGKTEVSSQWIRT
LIENDDRTGAAAISVVLLSISFIVLLILRVVGARAAKREEMAA
Blastp: Pre-computed results
TransMembrane prediction using Hidden Markov Models: TMHMM
Genomic sequence

Add extra bases upstream (5') and downstream (3')



Structural information
Protein Data BankNo structure available
PFAMP71745


Orthologs/Cross-references
CDC1551MT2470
Gene Ontologysulfate transport
sulfate transmembrane transporter activity
uptake transmembrane transporter activity
integral to membrane
M. bovisMb2421c
M. lepraeML0616
M. marinumMMAR_3717
M. smegmatisMSMEG_4532
UniProtP71745
Multiple Sequences Alignment: between orthologs


Interacting Drugs/Compounds
TDR TargetsRv2399c


Expression Data
TBDBRv2399c


Bibliography
Braibant M, Gilot P, Content J,
The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis
FEMS Microbiol Rev (2000) 24(4):449-67
Cited for: Review/Secondary
Wooff E, Michell SL, Gordon SV, Chambers MA, Bardarov S, Jacobs Jr WR, Hewinson RG, Wheeler PR,
Functional genomics reveals the sole sulphate transporter of the Mycobacterium tuberculosis complex and its relevance to the acquisition of sulphur in vivo
Mol Microbiol (2002) 43(3):653-63
Cited for: Homolog/Secondary/Function
Betts JC, Lukey PT, Robb LC, McAdam RA, Duncan K,
Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling
Mol Microbiol (2002) 43(3):717-31
Cited for: Transcriptome
Sassetti CM, Boyd DH, Rubin EJ,
Genes required for mycobacterial growth defined by high density mutagenesis.
Mol Microbiol (2003) 48(1):77-84
Cited for: Mutant
Griffin JE, Gawronski JD, Dejesus MA, Ioerger TR, Akerley BJ, Sassetti CM,
High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism.
PLoS Pathog (2011) 7(9):e1002251
Cited for: Mutant